(data stored in ACNUC1104 zone)

EMBL: CP002417.PE156

CP002417.PE156       Location/Qualifiers
FT   CDS_pept        159455..159820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_0403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34379"
FT                   /db_xref="GOA:E6V065"
FT                   /db_xref="UniProtKB/TrEMBL:E6V065"
FT                   /inference="similar to AA sequence:KEGG:Daro_0403"
FT                   /protein_id="ADU34379.1"
FT                   /translation="MVLDFCISFGLAAPVVLSVVLYQVGHRAVAQGRVGPVTASLVYGL
FT                   CVAALPLAVWWGVHALAEFYIVGEGTSFWKSVLQIGLAFLMYAYLCISWALSFVAACLA
FT                   TWRFTVCAKRLKQEALA"
     atggtcctcg acttctgcat ttccttcggc ctggccgccc ccgtggtgct gagcgtcgtt        60
     ctctatcagg tgggccatcg cgccgtcgcg caaggacgcg tgggtccggt gactgccagc       120
     ctcgtctatg gtctgtgcgt ggcggcgctg ccactggccg tatggtgggg cgttcatgcg       180
     ctcgcggagt tctacatcgt gggcgagggc acttcgttct ggaagtccgt gttgcagatc       240
     gggctggcct tcctcatgta cgcgtacctg tgcatctcgt gggccttgag ctttgtggcg       300
     gcctgcctgg ccacatggcg gttcaccgtc tgcgcgaagc ggttgaagca ggaagccctg       360
     gcctga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page