(data stored in ACNUC1104 zone)

EMBL: CP002417.PE157

CP002417.PE157       Location/Qualifiers
FT   CDS_pept        complement(159836..160558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0158"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pol:Bpro_5146 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34380"
FT                   /db_xref="GOA:E6V066"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V066"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34380.1"
FT                   /translation="MPEVLAFDQVTAGYGNAVVLDRLGFSLQQGESLAILGRNGVGKTT
FT                   LLETLMGNTRVMQGAIRWQGTDITRWPPHQRVRAGLGWVPQEREVFPSLTVEENLTVIA
FT                   RLGGWNLKRVYDFFPRLRERRGNYGNQLSGGEQQMLAIGRALMTNPKLLLLDEPMEGLA
FT                   PIIVEELSAAIRRLCESEGLASIVVEQHPVLALEMTHQAIVLERGTVVHAGPSAGLAAD
FT                   KGLLEGLLGVGIAEDVAG"
     atgcctgaag tgctcgcttt cgaccaggtc accgctggct acggcaacgc cgtggtgctc        60
     gaccgcctcg gcttctcgct gcagcagggc gagagcctcg cgatcctcgg gcgcaacggc       120
     gtgggcaaga ccacgctgct cgaaacgctg atgggcaaca cccgcgtgat gcagggcgcg       180
     atccgctggc agggcacgga catcacgcgc tggcccccgc accagcgcgt gcgcgcgggc       240
     ctgggctggg tgccgcagga gcgcgaggtg ttcccctcgc tcaccgtcga ggaaaacctc       300
     acggtgatcg cgcggctggg cggctggaac ctgaagcgcg tctacgactt ctttccgcgc       360
     ctgcgcgagc gccgaggcaa ctacggcaac cagctctcgg gcggcgagca gcagatgctg       420
     gccatcggcc gcgcactgat gaccaacccc aagctgctgc tgctcgacga gccgatggag       480
     gggctcgcac cgatcatcgt ggaggagctg tccgcggcga tccgccggct ctgcgaatcg       540
     gaagggctgg catcgatcgt ggtcgagcag cacccggtgc ttgcgctgga gatgacgcac       600
     caggccatcg tgctggagcg cggcaccgtc gtgcatgccg gcccgagcgc ggggctcgcg       660
     gccgacaagg ggttgctcga agggctgctg ggcgtgggaa tcgccgagga cgttgcgggc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page