(data stored in ACNUC1104 zone)

EMBL: CP002417.PE158

CP002417.PE158       Location/Qualifiers
FT   CDS_pept        complement(160551..161318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0159"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pol:Bpro_5147 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34381"
FT                   /db_xref="GOA:E6V067"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E6V067"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34381.1"
FT                   /translation="MTPTATHTLRTRDLGIRFGAFQAVSEVNLSLEPGSRQALIGPNGA
FT                   GKTTLINLLTGVFKPTSGSIHMGERDITRLSGDKRARMGLARTFQINTLFPSLTPLLSV
FT                   VLAISEREGLGATWWRPLKGCTAVFDEAHALLGTLKLDSLSDVPVSELAYGKQRLLEIA
FT                   LALAAKPRILLLDEPAAGVPEDESGELFAAIAALPDDISVLFIEHDMKLVFRFSRRISV
FT                   LVGGRILTEGTPAEIGADPRVRQVYLGSSHHHA"
     atgaccccca cagcgacgca caccctgcgc acccgcgacc tcggcatccg cttcggcgcc        60
     ttccaggcgg tgagcgaagt gaacctctcg ctcgagcccg gctcgcggca ggcgctgatc       120
     ggtcccaacg gcgcgggcaa gaccacgctc atcaacctgc tcaccggcgt gttcaagccc       180
     acgagcgggt cgatccacat gggcgagcgc gacatcacgc gcctgtcggg cgacaagcgc       240
     gcccgcatgg gcctcgcgcg caccttccag atcaacacgc tgttccccag cctcacgccg       300
     ctcctgtcgg tggtgctggc gatcagcgag cgcgaagggc tgggcgccac ctggtggcgg       360
     ccgctcaagg gctgcacggc agtgttcgac gaggcgcatg cgctgctcgg cacgctgaag       420
     ctcgacagcc tttccgacgt gccggtctcg gagctggcct acggcaagca gcggctgctg       480
     gagatcgcgc tcgcgctcgc ggccaagccc cgcatcctcc tgctcgacga gcccgcggcc       540
     ggtgtgcccg aggacgaaag cggcgagctc ttcgcggcca tcgcggcgct gccagatgac       600
     atcagcgtgc tcttcatcga gcacgacatg aagctcgtgt tccggttctc gcgccgcatc       660
     tcggtgctgg tgggcggacg catcctgacc gagggcacgc ccgcggaaat cggcgccgat       720
     ccgcgcgtgc gccaggtcta tctggggagt tcgcatcacc atgcctga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page