(data stored in ACNUC1104 zone)

EMBL: CP002417.PE159

CP002417.PE159       Location/Qualifiers
FT   CDS_pept        complement(161315..162277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0160"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   pol:Bpro_5148 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34382"
FT                   /db_xref="GOA:E6V068"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V068"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34382.1"
FT                   /translation="MKAFAVSPAQLRIAEVAFWLALASSFFLLPDKLTLMSQIMIFGLF
FT                   AVSLDMALGYAGILTVGHAAFFGAGAYAAGLLAKYGWSEPLTGLAFALVVSGLLGYALS
FT                   YLVVRGADLTRLMITIGVCVLLYELANRLSGITGGTDGLQGVVIAPVLGFFEFDLYGKT
FT                   AFGYAFGVVLAMFLLVRLVLRSPFGLALRGIHDSRKRMTAIGSPVEARLRMAYAFSAAV
FT                   AGVAGALLAQTTQFVGIESIGFNRSAEVLIILVLGGTGRLYGGMIGAIVYMLVHDWFAD
FT                   MNPQYWMFWLGIFLIAAVMLGRGGIMGALSRFVRTGKAR"
     atgaaggcct ttgcggtttc tcccgcgcag ctgcgcatcg ccgaagtcgc cttctggctc        60
     gcgctcgcgt ccagcttctt cctcttgccc gacaagctca cgctgatgag ccagatcatg       120
     atcttcggcc tgttcgccgt gtcgctcgac atggcgctcg gctacgcggg catcctcacc       180
     gtcggccatg cggccttctt cggcgcgggc gcgtacgctg ccggcctgct cgccaagtac       240
     ggctggagcg aacccctcac cggccttgcg ttcgcgctgg ttgtgagcgg cctcctcggc       300
     tatgcgctca gctacctcgt ggtgcgcggc gccgacctca cgcggctgat gatcaccatc       360
     ggcgtgtgcg tgctgctgta cgagctggcc aaccggctct cgggcatcac cggtggcacc       420
     gacgggctgc agggcgtggt catcgcgccg gtgctcggct tcttcgagtt cgatctctac       480
     ggcaagaccg cattcggcta cgccttcggt gtggtgctcg cgatgttctt gctggtgcga       540
     ctggtgctgc gctcgccctt cggcctggcg ttgcgcggca tccacgacag ccgcaagcgc       600
     atgacggcca tcggttcgcc ggtggaggcg cgcctgcgca tggcgtacgc cttctcggcc       660
     gcggtggccg gcgtggcggg cgcgctgctc gcgcagacca cgcagttcgt cggcatcgag       720
     tcgatcggct tcaaccgctc ggccgaggtg ctgatcatcc tggtgctcgg cggcaccggg       780
     cgcctgtacg gcgggatgat cggcgccatc gtctacatgc tggtgcacga ctggttcgcg       840
     gacatgaatc cgcagtactg gatgttctgg ctcggcatct tcctgatcgc ggcggtgatg       900
     ctagggcgcg gcggaatcat gggcgcgctc tcgcgcttcg tgcggacggg gaaggcgcga       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page