(data stored in ACNUC1104 zone)

EMBL: CP002417.PE163

CP002417.PE163       Location/Qualifiers
FT   CDS_pept        complement(164757..166211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0164"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   pol:Bpro_5153 L-glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34386"
FT                   /db_xref="GOA:E6V072"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:E6V072"
FT                   /inference="protein motif:PFAM:PF00120"
FT                   /protein_id="ADU34386.1"
FT                   /translation="MSSSNTNTFVDRFGLWSDDQHAQARELVRRIDSDEVDLVRFAWPD
FT                   QHGILRGKTLVATEARSALWEGVNLTSTLLAKDTSHKTVFPVFTTNGGFAIEGLQGGAD
FT                   FTIVADPATFKVLPWAPRTGWILCDAYMADGKPCPFATRQVLQRAVRQLDDLGLDFIAG
FT                   LEVEFHVFKLDDARMDLADSGQPGEPPRVSLLSHGHQYLTELRYDRVDGLMELLRSNLI
FT                   ALGLPLRSLEIEFGPSQFELTFGPTAGVMPADTMVLLRSAIKQICQRNGLHASFMCRPK
FT                   IPNVMSSGWHLHQSLRRKSDGVNAFMPETEGQDLSEIGMHYLGGLKAHACGAAALASPT
FT                   INGYRRYRPFSLAPDRAIWARDNRGAMLRVLGGVGQSASRIENRVGEPTANPYLYLASQ
FT                   LFSGLDGIRHKIDPGPSADAPYETPAEHLPRSLGDALACLRRDEMLNTQMGKVFIDYLC
FT                   HIKEAEIARFNLEVSEWEHREYFDMF"
     atgagcagca gcaacaccaa cacattcgtc gaccgcttcg gtctctggtc cgacgatcaa        60
     cacgcacagg cccgcgaact cgtgcgccgc atcgacagcg acgaggtcga cctcgtgcgc       120
     ttcgcctggc ccgaccagca cggcatcctg cgcggcaaga cgctggtcgc caccgaggcg       180
     cgctcggcgc tgtgggaggg cgtgaacctc acctccacgc tgctggccaa ggacacctcg       240
     cacaagacgg tgttcccggt cttcaccacg aatggcggct tcgccatcga gggcctgcag       300
     ggcggcgcgg acttcaccat cgtggccgac cccgccacct tcaaggtgct gccgtgggcg       360
     ccgcgcacgg gctggatcct gtgcgacgcc tacatggccg acggcaagcc ctgccccttc       420
     gcgacgcggc aggtcctgca gcgggcggtg cggcagctcg acgacctcgg actcgacttc       480
     atcgccggcc tcgaggtgga gttccatgtc ttcaagctgg acgatgcgcg catggacctg       540
     gccgactcgg gccagcccgg cgagccgccg cgcgtgtcgc tgctctcgca cggccaccag       600
     tacctgaccg agctgcgcta cgaccgcgtc gacggcttga tggagctgct gcgctcgaac       660
     ctcatcgccc tcggactgcc gctgcgctcg ctggaaatcg aattcggccc gagccagttc       720
     gagctgacct tcggccccac ggccggcgtg atgcccgccg acaccatggt gctgctgcgc       780
     agcgccatca agcagatctg ccagcgcaac gggctgcacg cgagcttcat gtgccggccg       840
     aagatcccga acgtgatgtc cagcggctgg cacctgcacc agtcgctgcg gcgcaagagc       900
     gacggcgtca acgcgttcat gcccgagacc gagggccagg acctgagcga gatcggcatg       960
     cactacctcg gcggcctgaa ggcgcatgcc tgcggcgcgg ccgcgctcgc gagccccacg      1020
     atcaacggct atcggcgcta ccgcccgttc tcgctcgcgc ccgaccgcgc gatctgggcg      1080
     cgcgacaacc gcggcgcgat gctgcgcgtg ctcggcggcg tgggtcagag cgcctcgcgc      1140
     atcgagaacc gcgtggggga gccgacggcg aatccgtacc tgtacctcgc atctcaactg      1200
     ttctcggggc tcgacggcat ccgccacaag atcgaccccg gtccctcggc cgatgcacct      1260
     tacgaaacgc cggccgaaca cctgccgcgt tcgctcggcg acgccctcgc ctgcctgcgc      1320
     cgcgacgaga tgctcaacac ccagatgggc aaggtcttca tcgactacct ctgccacatc      1380
     aaggaagcgg aaatcgcccg cttcaacctc gaagtcagcg agtgggaaca ccgcgagtac      1440
     ttcgacatgt tctga                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page