(data stored in ACNUC1104 zone)

EMBL: CP002417.PE164

CP002417.PE164       Location/Qualifiers
FT   CDS_pept        complement(166223..167554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0165"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   pol:Bpro_5154 Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34387"
FT                   /db_xref="GOA:E6V073"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E6V073"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADU34387.1"
FT                   /translation="MISAEQNDLITRVGPDAPAGKLLRRYWQPVALADELAGPRPVKPV
FT                   KLMGQDFVLFRDENGQLGMLDRDCPHRGADLAFGRLENGGIRCAFHGWLFDAKGNCLET
FT                   PAEPATSKLCSRIKQSAYPVVEKAGVVFAYIGEGEPPAFPDFDCFVAPDTHTFAFKGLF
FT                   ECNWLQALEVGIDPAHASYLHRFFEDEDTSESYGKQFRGASADSDMPITKVLREYDRPE
FT                   ISVEPAPYGFRLKALRKLSEDTTHVRVTNVVFPQAFVIPMSAEMTISQWHVPVDDTHCY
FT                   WYAIFTSFTGPVDKQQMRDQRLKLYELPDYTSRKNKRNNYGYSIDEQLTETYTGMGDDI
FT                   NVHDQWAVESQGAIQDRTREHLGSTDKGIIAYRRVLVKAIEATLAGETAPMLIDAAQAS
FT                   TMTGPPSIDGIGHVVDEAATETYWQEADRARRLKSDWASARLAA"
     atgatcagcg ccgagcaaaa cgatctcatc acccgcgtcg gacctgacgc ccccgccggc        60
     aagctgctgc gccgctactg gcagccagtg gccctggccg acgaactggc aggcccgcgc       120
     ccggtcaagc ccgtgaaact catgggccag gacttcgtgc tgttccgcga cgaaaacggc       180
     cagctcggca tgctcgaccg cgactgcccg caccgcggcg ccgacctcgc cttcggacgg       240
     ctggaaaacg gcggcatccg ctgcgccttc cacggctggc tgttcgacgc caagggcaac       300
     tgcctcgaaa cgcccgccga acccgccacc agcaagctgt gcagccgcat caagcagtcg       360
     gcctatccgg tggtcgaaaa ggcgggcgtg gtcttcgcgt acatcggcga aggcgagccc       420
     ccggccttcc ctgacttcga ctgcttcgtc gcccccgaca cccacacttt cgcgttcaag       480
     ggcctgttcg aatgcaactg gctgcaggcg ctcgaagtgg gcatcgaccc cgcgcacgcc       540
     tcgtacctgc accgcttctt cgaggacgag gacacgtccg agagctacgg caagcagttc       600
     cgcggcgcct cggccgattc ggacatgccg atcaccaagg tgctgcgcga gtacgaccgg       660
     cccgagatca gcgtggagcc cgcgccttac ggcttccgcc tgaaggcgct gcgcaagctc       720
     tccgaggaca ccacccacgt gcgcgtgacc aacgtggtgt tcccgcaggc cttcgtgatc       780
     ccgatgagcg cggagatgac catctcgcag tggcacgtgc cggtcgacga cacgcactgc       840
     tactggtacg ccatcttcac cagcttcacc ggcccggtcg acaagcagca gatgcgcgac       900
     cagcgcctga agctctacga gctgcccgac tacacctcgc gcaagaacaa gcgcaacaac       960
     tacggctaca gcatcgacga gcagctcacc gaaacctaca ccggcatggg cgacgacatc      1020
     aacgtgcacg accagtgggc ggtggagtcg cagggagcca tccaggaccg cacgcgcgag      1080
     cacctgggca gcaccgacaa gggaatcatt gcctaccgcc gcgtgctggt gaaggccatc      1140
     gaggccacgc tggccggcga gaccgcgccg atgctcatcg acgccgcaca ggccagcacg      1200
     atgaccggcc cgccctccat cgacggcatc ggccacgtgg tcgatgaagc cgccaccgag      1260
     acctactggc aggaagccga ccgcgcgcgg cgcctgaagt ccgactgggc ctccgcacgg      1320
     ctcgccgcct ga                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page