(data stored in ACNUC1104 zone)

EMBL: CP002417.PE165

CP002417.PE165       Location/Qualifiers
FT   CDS_pept        167839..168573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0166"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: pol:Bpro_5155 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34388"
FT                   /db_xref="GOA:E6V074"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V074"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADU34388.1"
FT                   /translation="MDSQQSRVLVQLRDMILKGEFVPGERLAEIPLAEKLEASRTPVRL
FT                   ALASLEHEGLIEQSPSGGYQMRRFTSQEVADAIRVRGVIEGFAARLLAEDGASRQLLRD
FT                   LKDCLDAGDRAVNKPTMEIDDYAAYVEMNDRFHKLIVEGCGNLALKRVMDMLGGQPFAA
FT                   PSAMLPMQSSMEEGQQWMRQAHRTHHAMVQAIERGQGSRAQALGEEHVEIARMNLDYAL
FT                   ERPELAAELMPGIKLVSKGRNA"
     atggactctc aacaatcccg cgtgctcgtg cagttgcgcg acatgatcct caagggtgaa        60
     ttcgtgcctg gagagcggct ggccgagatc ccgctcgccg aaaagctcga agcctcgcgc       120
     accccggtgc gccttgcgct cgccagcctc gagcacgaag gcctcatcga acaatcgccc       180
     agcggcggct accagatgcg ccgcttcact tcgcaggaag tggccgacgc gatccgcgtg       240
     cgcggcgtga tcgaaggttt cgcggcgcgc ctgctggccg aagacggcgc atcgcgccag       300
     ctgctgcgcg acctgaagga ttgcctggac gccggcgatc gggcggtgaa caagcccacg       360
     atggaaatcg acgactacgc cgcctacgtc gagatgaacg accgcttcca caagctgatc       420
     gtcgaaggct gcggcaacct cgcgctcaag cgggtgatgg acatgctcgg cggccagccc       480
     ttcgccgcgc ccagcgcgat gctgccgatg cagtcgtcga tggaagaggg ccagcagtgg       540
     atgcgccagg cgcaccgtac gcaccatgca atggtgcagg ccatcgagcg tgggcagggt       600
     tcgcgcgcac aggcgctggg cgaggagcac gtcgagatcg cgcgcatgaa cctcgattac       660
     gcgctggagc ggcccgagct cgcggccgag ttgatgccgg gcatcaagct ggtttccaaa       720
     gggcgcaacg cctga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page