(data stored in ACNUC1104 zone)

EMBL: CP002417.PE166

CP002417.PE166       Location/Qualifiers
FT   CDS_pept        168662..169285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0167"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pol:Bpro_0153
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34389"
FT                   /db_xref="GOA:E6V075"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:E6V075"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU34389.1"
FT                   /translation="MTTAAAAPAKPSFKEQMLQAREEAIVQTANRLLAEKGFESMTVDE
FT                   VAASVGIAKASLYKHFPSKEDLAAAAMVRLMQRTQDVLASVQVDQKPIDKLRAVVRWSM
FT                   EAQLAGEMPSLPHQNSSLRAALMNNRGYLDRLVAISDTLGGWIQAAQADGTLNPKLPAI
FT                   AVLYTLFARACDPVLGFLKSSGLQSDAEIVDLVLGTCFDGLASR"
     atgaccactg ctgctgccgc ccccgccaag ccctcgttca aggaacagat gctgcaggcc        60
     cgcgaagagg ccatcgtcca gaccgcgaac cgtctgctcg ccgagaaggg tttcgaatcg       120
     atgacggtcg acgaggtcgc ggcctccgtc ggcatcgcca aggccagtct ctacaagcac       180
     tttcccagca aggaagacct cgcggccgcc gcgatggtgc gcctcatgca gcgcacgcag       240
     gatgtgctgg cgtcggtgca ggtcgaccag aagcccatcg acaagctgcg cgccgtggtg       300
     cgctggtcca tggaagcaca gctggccggc gagatgccat cgctgccgca ccagaactcg       360
     agcctgcgcg ccgcgctgat gaacaaccgc ggctatctcg accggctggt tgcgatcagc       420
     gacacgctcg gcggctggat ccaagccgcg caggccgatg gcacgctgaa cccgaagctg       480
     cccgcgattg ccgtgctcta cacgctgttc gctcgcgcct gcgatccggt cctcgggttt       540
     ctcaagtcga gcgggctgca aagcgatgcg gagatcgtcg acctggtgct cggcacctgt       600
     ttcgacgggc tcgcctcgcg ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page