(data stored in SCRATCH zone)

EMBL: CP002417.PE167

CP002417.PE167       Location/Qualifiers
FT   CDS_pept        complement(169368..170174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0168"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: vap:Vapar_0143
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34390"
FT                   /db_xref="GOA:E6V076"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:E6V076"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADU34390.1"
FT                   /translation="MKLQLLSDLHLESNPRFHAEPIPGADLLVLAGDIGSYQEGSRLPD
FT                   TDFGLGRFSPRNGWPVPVIYVPGNHEYDNADFDETHDRLRALCAELDIQWLERETLVIE
FT                   GIRFVGTTLWADFDALVEPTDGLAEALKKRGKAMRAADFYLEKMATRRHGEIFLSGPLR
FT                   EQALVCQAWLREALAQPFDGTTVAITHFAPTLASADPRYGLTPGTAGFCNSLDELLPNA
FT                   QLWLHGHLHCAFDYVKDGCRVVANPLGYKRNGEQEGYRPDLLIDVK"
     atgaagcttc aactgctctc cgacctgcac ctggagtcca acccccgctt ccacgccgag        60
     ccgattccgg gcgccgatct gctggttctg gcgggcgaca tcggctcgta ccaggaaggc       120
     tcccgcctcc cggacaccga cttcggcctg ggccgttttt cgccccgcaa cggctggccg       180
     gtgccggtga tctatgtgcc gggcaaccac gaatacgaca acgccgattt cgacgagacg       240
     cacgaccgcc tgcgcgcgct ctgcgccgag ctcgacatcc agtggctcga gcgcgaaacc       300
     ctcgtcatcg agggcatccg cttcgtcggc accacgctct gggccgactt cgacgcgctg       360
     gtggaaccca ccgacggttt ggccgaagcg ctcaagaagc gcggcaaggc gatgcgcgct       420
     gccgatttct atctggaaaa gatggccacc cggcgccacg gcgaaatctt cctgtccggc       480
     ccgctgcgcg agcaggcgct cgtgtgccag gcgtggctgc gcgaagcgct ggcccagcct       540
     ttcgacggca ccacggttgc catcactcac ttcgcgccga cattggcaag cgccgatccg       600
     cgctacggtc tgacgcccgg caccgccggt ttctgcaatt ccctggacga actcctgcca       660
     aacgcccagc tctggctgca cggccatctg cactgtgcct tcgactatgt gaaggacggc       720
     tgccgcgtgg tggccaatcc gctgggctac aagcgcaacg gcgagcaaga gggctacagg       780
     cccgacctgc tcatcgacgt gaaatag                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page