(data stored in SCRATCH zone)

EMBL: CP002417.PE169

CP002417.PE169       Location/Qualifiers
FT   CDS_pept        complement(170489..171469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0170"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0145 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34392"
FT                   /db_xref="GOA:E6V078"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:E6V078"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34392.1"
FT                   /translation="MDVNFRTLDLNLLRVFDEVMAERNLTRAARNLSITQPAVSNALRR
FT                   LREVIGDELVRRAGAGVEPTPRALALWPTVRDALRQLQHTLAPGEFDAATADTTFLLAM
FT                   ADATAAELIPGLVQIAEKEAPAISLRVLPLTTRDPRRMLENEEVDMAIGYFPAVIASLA
FT                   ARGQSGVGVPFETQRLYLGQYVCVMRRGHPLANAPLTLDDYCAARHLLVSFSGRPYGFI
FT                   DQTLGAMGRERRIVVTVNQFFTAGRVVANSDLLTVLPRHFVTVTGIDDQLVLRDLPFDQ
FT                   PPVHVDAIWHRRAQHGHAHEWLRTALLRSAAAAFAGSILGQKVPD"
     atggatgtca actttcgcac gctcgacctc aacctgcttc gcgtcttcga cgaggttatg        60
     gcggagcgca acctcacgcg cgccgcccgc aacctctcta ttacccagcc ggcagtgagc       120
     aatgccctgc ggcgccttcg cgaggtgata ggtgacgaac tggtgcgccg cgcaggtgct       180
     ggcgtggagc ccacgccgcg ggcgctggcg ctctggccca cagtgcgcga cgcgctgcgc       240
     cagctgcaac acaccctggc cccaggcgag ttcgacgcag cgaccgccga caccaccttc       300
     ctgctggcca tggccgatgc caccgcggcg gagttgattc ccggcctggt gcagatcgcc       360
     gaaaaggaag cgcccgccat ttccctgcgc gtgctcccgc tgaccacgcg cgatccgcgc       420
     cggatgctgg agaacgaaga ggtcgacatg gcgatcggct acttcccggc cgtcatcgcc       480
     agcttggcgg cgcggggcca atcgggagtg ggggtgccgt tcgagaccca gcggctctac       540
     ctgggccaat atgtatgcgt gatgcgccgt ggccatccgc tcgcgaacgc gccgctcacg       600
     ctggacgact actgcgccgc gcggcatcta ttggtaagtt tctcggggcg cccatacggc       660
     ttcatcgacc agacgctcgg cgccatgggg cgcgagcggc gcatcgtggt gacggtgaac       720
     cagttcttta cggcgggccg ggtggtcgct aattcagacc tcttgaccgt gctgccccgc       780
     cacttcgtga ccgtgaccgg catcgacgac caattggtgc tgcgcgacct gcccttcgac       840
     cagccgccgg tgcacgtgga tgccatctgg caccggcgcg cccagcatgg gcatgcgcat       900
     gaatggctgc ggaccgcgct gttgcggtcg gccgcggcag ccttcgcggg ctcgatcctc       960
     gggcagaagg tgcccgactg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page