(data stored in ACNUC1104 zone)

EMBL: CP002417.PE17

CP002417.PE17        Location/Qualifiers
FT   CDS_pept        complement(16880..17776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0017"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: vap:Vapar_0017
FT                   pirin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34240"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP6"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="ADU34240.1"
FT                   /translation="MGRMTKNANHPTEPVATPRGLDHIVAGVSTSDGDGVKLTRVLQQP
FT                   LQKRLDPYLMLDAFGSDNPGDYIGGFPNHPHRGFETVTYMIAGRMRHRDSAGHEGLLEN
FT                   GGVQWMTAGRGLVHSELPEQEEGLMEGFQLWLNLPAKDKMREPWYRDIQSEEIPEYTTA
FT                   EGVHVRVIAGTSHGIEGAVLRAHTEPLYLDLTLPPGAEFAQPLPADHNVLVYVFRESLW
FT                   IAGSEVPTRRMAILANDVGSDGVVLRAGATNHSPARALLIAGRPLHEPIAQYGPFVMNT
FT                   QEEVKQAVHDFQNGQLG"
     atgggtcgca tgaccaagaa cgccaaccac cccaccgaac ccgttgccac gccccgcggc        60
     ctcgaccaca tcgtggccgg tgtctccacc agcgacggcg acggcgtcaa gctcacccgc       120
     gtgctgcagc agccgctgca gaaacggctc gatccgtacc tgatgctcga tgccttcggc       180
     agcgacaacc cgggcgacta catcggcggc tttccgaacc atccgcaccg gggcttcgaa       240
     accgtcacct acatgatcgc gggccgcatg cgacaccgcg acagcgccgg ccacgaaggc       300
     ctgctcgaaa acggcggggt gcagtggatg accgccggcc gcggcctcgt gcacagcgag       360
     ctgcccgagc aggaagaagg cctcatggaa ggctttcagc tctggctcaa cctgccggcc       420
     aaggacaaga tgcgcgagcc ttggtatcgc gacatccaga gcgaggagat tcccgaatac       480
     accaccgccg aaggcgtgca cgtgcgggtg atcgccggca ccagccacgg catcgaaggc       540
     gcggtgctgc gcgcgcacac cgagccgctc tacctggacc tcacgctgcc gcccggcgcc       600
     gaattcgcgc agccgctgcc ggcggaccac aacgtgctgg tctacgtgtt ccgcgaatcg       660
     ctctggatcg ccgggagcga agtgccgacg cgccgcatgg cgatcctcgc caacgacgtc       720
     ggcagcgacg gcgtggtgct gcgcgcgggc gcgaccaacc acagcccggc gcgcgcgctg       780
     ctcatcgcgg gccggccgct gcacgaaccc atcgcgcagt acgggccgtt cgtgatgaac       840
     acgcaggagg aagtgaaaca ggccgtgcac gatttccaga acggccagct cggctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page