(data stored in ACNUC1104 zone)

EMBL: CP002417.PE170

CP002417.PE170       Location/Qualifiers
FT   CDS_pept        171580..172122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34393"
FT                   /db_xref="GOA:E6V079"
FT                   /db_xref="UniProtKB/TrEMBL:E6V079"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0146"
FT                   /protein_id="ADU34393.1"
FT                   /translation="MTSFVHVDQPTVHPGVRRAEVLFGQIQAARAGAEGARPLIALFIV
FT                   AIAAAVLVVADTLVSNWNEGALLAAWTIFCLAAIALFALFASSVRKSSIASLWQAAAER
FT                   RAANRADARFMETAKNDPRVMQELQAAVWRQQSEGTVPAAAVAKVDALARMSTRSQEAR
FT                   MPTLYEAMRRMNSSRYY"
     atgaccagct ttgtccacgt tgaccaacct actgttcacc ccggcgtccg tcgcgccgaa        60
     gtcctgttcg gccagatcca ggccgcccgc gcaggcgccg aaggcgcccg tccgctgatc       120
     gccttgttca tcgttgccat cgctgcagcg gttctggtgg tcgccgacac gctcgtctcc       180
     aactggaacg aaggcgcatt gctcgccgca tggaccatct tctgcctcgc agcgatcgcg       240
     ttgtttgccc tgttcgccag ctcggtgcgc aagagcagca tcgccagcct ctggcaagct       300
     gctgccgagc gccgcgctgc aaaccgggct gatgcacgtt tcatggaaac tgcgaagaac       360
     gacccacgcg tgatgcagga actgcaagct gccgtgtggc gccagcaatc ggaaggcact       420
     gtgcctgccg ctgcagttgc caaggtcgac gcgctggctc gcatgagcac ccgctcgcag       480
     gaagcgcgca tgccgacgct ctatgaagcg atgcgccgca tgaacagctc gcgctattac       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page