(data stored in SCRATCH zone)

EMBL: CP002417.PE171

CP002417.PE171       Location/Qualifiers
FT   CDS_pept        complement(178319..180184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0172"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="KEGG: vap:Vapar_0147 phosphoenolpyruvate
FT                   carboxykinase; PFAM: phosphoenolpyruvate carboxykinase
FT                   (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34394"
FT                   /db_xref="GOA:E6V080"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:E6V080"
FT                   /inference="protein motif:PRIAM:4.1.1.32"
FT                   /protein_id="ADU34394.1"
FT                   /translation="MNAPTMKGLTIQAPSYVKNAKLIAWVADMAALCKPESIYWCDGSK
FT                   EEYDRLCQQLVDAGTFKKLNPAKRPNSFLAVSDPTDVARVEDRTFICSNEKESAGPTNN
FT                   WMAPAEMRATLQPLFDGCMKGRTMYVVPFSMGPLGSPIAHIGIELSDSPYVAVNMRIMT
FT                   RMGKAVYEVLGADGEFVPCVHTVGAPLEAGQKDVSWPCNKTKYIVHYPETREIWSYGSG
FT                   YGGNALLGKKCFALRIASNMGRDEGWLAEHMLILGVTNPEGKKYHVAAAFPSACGKTNF
FT                   SMLVPPAGFEGWKVTTIGDDIAWIKPGKDGRLYAINPEAGYFGVAPGTNMLTNPNCMDS
FT                   LNSDVIFTNVALTDDGDVWWEGMEQDTKTLPEHLTDWQGKDWTPQIAKETGAKAAHPNS
FT                   RFTVAATNNPALDDAWDDPKGVAIDAFIFGGRRSTTVPLVTEAHNWVEGVYMAATMGSE
FT                   TTAAAGGQQGVVRRDPFAMLPFAGYNMADYFQHWLNVGKKLEASGAKLPKIYTTNWFRK
FT                   GADGKFVWPGYGENMRVLKWMIDRIEGKKTEGVEHITGVSPRYEDLNWTGLEFSAEQFA
FT                   TVTSIDKAAWQAELKLHAELFQQLSHHLPKELPETKAAIEQRLAA"
     atgaacgcac ccacgatgaa gggcctcacc attcaggcgc cctcatacgt caagaacgcg        60
     aaactgattg cctgggtggc cgacatggcc gcgctgtgca aacccgagtc catctactgg       120
     tgcgacggca gcaaggagga gtacgaccgc ctctgccaac aactggtcga cgcgggcacc       180
     ttcaagaagc tcaaccccgc caagcgcccc aattcgttcc tcgcggtgtc cgacccgacc       240
     gacgtcgcgc gcgtcgaaga ccgcaccttc atctgttcca acgaaaaaga gagcgccggc       300
     cccaccaaca actggatggc cccggccgaa atgcgtgcga cgctgcagcc gcttttcgac       360
     ggctgcatga agggccgcac gatgtatgtg gtgccgttca gcatgggccc gctgggttcg       420
     ccgatcgcac acatcggcat cgaactctcc gactcgcctt acgtggcggt caacatgcgc       480
     atcatgaccc gcatgggcaa ggccgtgtac gaggtgctcg gcgccgacgg cgagttcgtg       540
     ccctgcgtgc acaccgtggg tgcgccgctc gaagctgggc aaaaggacgt gtcctggccc       600
     tgcaacaaga ccaagtacat cgttcactac cccgagacgc gcgagatctg gagctatggc       660
     tcgggctacg gcggcaatgc gctgctgggc aagaagtgct tcgcgctgcg catcgcctcg       720
     aacatgggcc gcgacgaagg ctggctggcc gagcacatgc tgatcctcgg cgtgacgaac       780
     cccgagggca agaagtacca cgtggccgcc gctttcccga gtgcctgcgg caagacgaat       840
     ttctcgatgc tggtgccgcc cgctggtttc gaaggctgga aggtcacgac catcggcgac       900
     gacatcgcct ggatcaaacc cggcaaggac ggccgcctgt acgcgatcaa tcccgaagcc       960
     ggttatttcg gcgtggcgcc cggcaccaac atgctgacca acccgaactg catggacagc      1020
     ctgaacagcg acgtgatctt cacgaatgtc gcgctgaccg acgacggtga cgtctggtgg      1080
     gaaggcatgg agcaggacac caagacgctg cccgagcacc tgaccgactg gcagggcaag      1140
     gactggacgc cgcagatcgc caaggaaacg ggcgccaagg cagcgcaccc caactcgcgc      1200
     ttcaccgtgg ccgcgaccaa caacccggca ttggatgacg cctgggacga tccgaagggt      1260
     gtggcgattg acgccttcat cttcggcggc cgccgctcga cgaccgttcc gttggtgacc      1320
     gaagcccaca actgggtcga aggcgtctac atggctgcaa cgatgggctc tgaaaccacg      1380
     gcagccgccg gcggccagca aggcgtggtg cgccgcgacc cgttcgcgat gctgccgttc      1440
     gccggctaca acatggccga ctacttccag cattggctca acgtcggcaa gaagctcgaa      1500
     gcatcgggcg cgaagctgcc gaagatctat acgaccaact ggttccgcaa gggcgccgac      1560
     ggcaagttcg tctggcctgg ttacggcgag aacatgcgcg tgctgaagtg gatgatcgat      1620
     cgcatcgaag gcaagaagac cgaaggcgtc gagcacatca ctggtgtgag cccgcggtat      1680
     gaagatctga actggacggg gctggaattc agcgccgagc aattcgcgac tgtgaccagc      1740
     atcgacaagg cagcctggca agcggaactg aagctgcacg cggagttgtt ccaacaactg      1800
     tcgcatcacc tgccaaagga attgccggag accaaggctg ctattgagca gcgcttggct      1860
     gcctga                                                                 1866
//

If you have problems or comments...

PBIL Back to PBIL home page