(data stored in ACNUC1104 zone)

EMBL: CP002417.PE173

CP002417.PE173       Location/Qualifiers
FT   CDS_pept        complement(180582..181790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0174"
FT                   /product="threonine dehydratase"
FT                   /note="KEGG: vap:Vapar_0149 threonine dehydratase; TIGRFAM:
FT                   threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34396"
FT                   /db_xref="GOA:E6V082"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E6V082"
FT                   /inference="protein motif:TFAM:TIGR01127"
FT                   /protein_id="ADU34396.1"
FT                   /translation="MRAMVGIEEIRRAAVRLQGQVLNTPCVESRTLSEIVGAQVFLKFE
FT                   NLQFTSSFKERGACNKLVDLSEAGTRGVIAMSAGNHAQGVAYHAQRLGLRALIVMPRFT
FT                   PGVKIERTRGFGAEVVLHGDTLDAARAHALELAEREGLAFVHPYDDEAIIAGQGTVALE
FT                   MLDAVPDLDTLVVAVGGGGLIAGMAVAARDRKPGIEIVGVQTTRFPGMVNAIKGTHHAQ
FT                   GKSTIAEGIAVGTPGVLTQEIIASKVDDLVLVDEGDIEQGVLMLLEIEKTLVEGAGAAG
FT                   LAALIRHPERFKGKRVGLVLSGGNIDPLLLAAIIERGMVRAGRLARVRVSARDVPGSLA
FT                   EITATVAEAGANVDEVHHQRAFTMLAAQNVDIELVLQTRGRAHLASVLTALKDAGFEAE
FT                   EQH"
     atgcgcgcca tggtcggaat cgaagaaatc cggcgcgccg cggtgcgcct ccagggtcag        60
     gtgctcaata cgccctgtgt cgaatcacgc acgctctccg aaatcgtcgg cgcgcaggtg       120
     ttcctgaaat tcgagaacct gcagttcaca tcctccttca aggagcgggg tgcctgcaac       180
     aagctggtcg acctgtcgga ggcgggcacg cgcggcgtga tcgccatgtc ggccggcaac       240
     cacgcgcagg gtgtggccta tcacgcgcag cggctgggcc ttcgggcgct gatcgtgatg       300
     ccgcgcttca cgcccggcgt gaagatcgag cgcacccgcg gctttggcgc cgaggtggtg       360
     ctgcacggcg acacgctcga tgcggcgcgc gcgcatgcat tggagcttgc cgagcgcgaa       420
     ggactggcct tcgtgcaccc ctacgacgac gaagccatca tcgccggcca gggcactgtc       480
     gcactcgaaa tgctcgacgc ggtgcccgac ctcgacacgc tggtcgtggc ggtcggcggc       540
     ggcgggctca tcgccggcat ggcggtcgcg gcacgcgatc gcaagcccgg catcgagatc       600
     gtcggcgtgc agaccacgcg cttcccgggc atggtcaacg ccatcaaggg cacgcaccac       660
     gcgcagggca agagcaccat cgccgaaggc atcgcggtgg gtacgccggg cgtgctgacg       720
     caggaaatca tcgcgagcaa ggtcgacgac ctggtgctgg tggacgaagg cgacatcgag       780
     cagggcgtgc tgatgctgct cgagatcgaa aagaccctgg tcgaaggtgc gggtgctgcg       840
     ggccttgcgg cgctgatccg gcatccggaa cgcttcaagg gcaagcgcgt cgggctggtg       900
     ctctcgggcg gaaacatcga tccgctgctg cttgcggcca tcatcgagcg cggcatggtc       960
     agggccgggc ggctggcgcg ggtgcgtgtg agtgcgcgcg acgtgccggg ctcactggcc      1020
     gagatcacgg caactgtcgc cgaagcgggc gctaacgtcg acgaggttca ccatcagcgc      1080
     gccttcacca tgctcgcggc ccagaacgtg gatatcgagc tggtcctgca aacccgcgga      1140
     agggcgcacc tggccagcgt gttgactgca ctgaaagacg ccggcttcga ggccgaggag      1200
     cagcattga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page