(data stored in ACNUC1104 zone)

EMBL: CP002417.PE176

CP002417.PE176       Location/Qualifiers
FT   CDS_pept        186066..187256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0177"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: vap:Vapar_0152 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34399"
FT                   /db_xref="GOA:E6V085"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:E6V085"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ADU34399.1"
FT                   /translation="MRKLHKWIGAVFALVAAAVVAGCGGGGDGNGGFGLAPGFGGPPPP
FT                   AQKIIIDSDYNTMSDDGQLGVMAAQLQAEGKVQVMGISVVSGNQWLKQGVADALMSVER
FT                   LGVGDRIGVYVGENYALNHTFADVEAEMAAGAGGDGYLGAWSGPEPKTDADLKPSPDGF
FT                   ATRTLVQRKSAVDFIIDTVKANPNEITILAIGPLTNIALAVKKSPDIIPLIKKIVYMGG
FT                   AIDVPGNTTKAAEFNWWFDPDAAQFVVRLPIPQVVVPLDVTDTVFLTKPIYDRIAHPAK
FT                   PTAVTEVFRKLNGYGFSGTNGFENNPDYTQNIWDTLTLAYLIDPTYATRTVERYVDVVA
FT                   KPGAADNGRSIGYASQPAGPTLQKMTVVQRFDNTRFFELFVDLLTRPVPITLPPAN"
     atgcgcaagt tgcacaaatg gatcggggcc gttttcgccc tcgtcgccgc ggccgtggtg        60
     gcgggctgcg gcggaggcgg tgacggcaac gggggcttcg ggctcgcgcc cggcttcggc       120
     ggtccgccgc cgcctgcgca gaagatcatc atcgacagcg actacaacac catgagcgac       180
     gacggccagc ttggcgtcat ggccgcgcag ctgcaggccg agggcaaggt ccaggtcatg       240
     ggcatcagcg tggtctcggg caaccagtgg ctcaagcaag gcgtggccga tgcgctgatg       300
     tcggtcgagc ggctcggcgt gggcgaccgc atcggcgtgt acgtgggcga gaactacgcg       360
     ctcaaccaca ccttcgccga cgtcgaggcc gaaatggcgg cgggcgcggg cggcgacggc       420
     tacctgggcg cctggagcgg ccccgagccc aagaccgacg ccgacctgaa gccttcgccc       480
     gacggctttg ccacccgaac gctggtgcag cgcaagagcg cggtcgactt catcatcgac       540
     acggtcaagg ccaatccgaa cgagatcacc atcctggcca tcggcccgct caccaacatc       600
     gcgcttgcgg tgaagaagag ccccgacatc attccgctga tcaagaagat cgtctacatg       660
     ggcggcgcga tcgacgtgcc gggcaacacc accaaggccg ccgagttcaa ctggtggttc       720
     gaccccgatg ccgcgcagtt cgtggtgcgc ctgccgatcc cgcaggtggt ggtgccgctg       780
     gacgtgaccg acaccgtgtt cctcaccaag ccgatctacg accgcatcgc ccatccggcc       840
     aagccgaccg cggtgacgga agtgttccgc aagctcaacg gctacggctt cagcggcacg       900
     aacggcttcg agaacaaccc cgactacacg cagaacatct gggacaccct cacgctggcc       960
     tacctgatcg atccgaccta cgcgaccagg acggtggagc gctatgtcga cgtggtcgcc      1020
     aagccgggcg ccgcggacaa cggccgctcc atcggctacg cctcgcagcc cgcgggcccg      1080
     acgctgcaga agatgacggt ggtgcagcgc ttcgacaaca cgcgcttctt cgagctcttc      1140
     gtcgacctgc tgacgcggcc ggtgccgatc acgctgccgc cggcgaactg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page