(data stored in ACNUC1104 zone)

EMBL: CP002417.PE178

CP002417.PE178       Location/Qualifiers
FT   CDS_pept        189474..190520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0179"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="KEGG: vap:Vapar_0154 extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34401"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:E6V087"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0154"
FT                   /protein_id="ADU34401.1"
FT                   /translation="MVKTVNISAPEPAAARQAPRGGQENLGRPGVFLKVASLLAAGACA
FT                   AGMAGTAAAQDTKIALGMSGWTGFAPLSLADKAGIFKKNGLDVELKMIPQKDRHLALAS
FT                   GAIQCAATTVETHVAWNANGVPIVQIFQMDKSYGADGIAVRNDVKTFADLKGKSIGVSA
FT                   PGTAPYFGLAWMLSKNGMSLKDVKVVSLEPQPAAQAFVAGQNDAAMTYEPYLSTVRANP
FT                   AAGKILATTLDYPMVMDTVGCAPTWLKANPKAAAALTKSYFDALDMIKADPAKSNELMG
FT                   SAVKQSGEQFAKSSAYLRWQDKAANQKFFAGELTTFMKEAAAILLEAGVIRKAPEDYAV
FT                   TFDASYVK"
     atggtcaaga cggtaaatat cagcgccccc gaacctgccg ctgcgcgtca ggccccccga        60
     gggggacaag aaaacttggg gcggcccggc gttttcttga aagtcgcttc gctgctggca       120
     gcaggtgcat gtgcagcggg catggccgga acggccgccg cccaggacac caagattgca       180
     ctcggcatgt ccggctggac cggcttcgcg ccgctctcgc tggccgacaa ggccggcatc       240
     ttcaagaaga acgggctgga cgtcgaactg aagatgattc cgcagaagga ccgccacctg       300
     gcgctggcct ccggcgccat ccagtgcgcc gccaccaccg tggaaacgca cgtcgcctgg       360
     aacgccaacg gcgtgccgat cgtgcagatc ttccagatgg acaagtccta cggcgccgac       420
     ggcatcgcgg tgcgcaacga cgtgaagacc ttcgccgacc tcaagggcaa gtccatcggc       480
     gtgagcgccc ccggcactgc gccgtatttc ggcctggcct ggatgctcag caagaacggc       540
     atgagcctga aggacgtgaa ggtcgtctcg ctcgagcccc agcccgccgc gcaagccttc       600
     gtggccggcc agaacgacgc cgccatgacc tacgagccct acctctcgac cgtgcgcgcc       660
     aacccggccg ccggcaagat cctcgcgacg acgctcgact acccgatggt gatggacacc       720
     gtcggctgcg cgccgacctg gctcaaggcc aaccccaagg ccgcggccgc gctcaccaag       780
     tcgtacttcg acgcgctgga catgatcaag gccgacccag ccaagtcgaa cgagctcatg       840
     ggctcggccg tcaagcagag cggcgagcag ttcgccaagt cgtcggcgta cctgcgctgg       900
     caggacaagg cggccaacca gaagttcttc gcgggcgaac tcaccacctt catgaaggaa       960
     gccgcggcga tccttctgga agccggcgtg atccgcaagg cccctgaaga ctacgcagtc      1020
     accttcgatg caagctacgt caagtaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page