(data stored in SCRATCH zone)

EMBL: CP002417.PE179

CP002417.PE179       Location/Qualifiers
FT   CDS_pept        190501..191382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0180"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0155
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34402"
FT                   /db_xref="GOA:E6V088"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V088"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34402.1"
FT                   /translation="MQATSSKALPQQVPPRAASAGAASSQPVVPPVRRRAFAPLEPIGA
FT                   RARVLLGLGFFVVFVLVWSLATLGGFVSPTFLASPPTMVKEGWLLFTEYGFIGDIGMTV
FT                   WRVFGGFLLAAVFAVPLGIAMGTWKTVEAFFEPFVSFCRYLPASAFIPLLILWAGLGEM
FT                   QKLLVIFIGSFFQIVLMVAVTVGGARRDLVEAAYTLGANSRGIVARVLIPGAAPGIAET
FT                   LRLVLGWAWTYVIVAELIGSSSGIGHMITDSQALLNTGQIIFGIIVIGVIGLLSDFAFK
FT                   ALNRRLFAWAAL"
     atgcaagcta cgtcaagtaa ggcgctgccg cagcaggtgc cgcctcgcgc ggcatcggcg        60
     ggcgccgcgt cctcccagcc cgtcgtgcct cccgtgcgcc gccgcgcgtt cgcgccgctc       120
     gaacccatcg gcgcccgtgc gcgggtgctg ctggggctcg gcttcttcgt cgtgttcgtg       180
     ctcgtgtggt cgctcgccac gctcggcggc ttcgtgtcgc cgaccttcct cgcgagcccg       240
     ccgaccatgg tcaaggaagg ctggctgctc ttcaccgagt acggcttcat cggcgacatc       300
     ggcatgaccg tgtggcgcgt gttcggcggc ttcctgttgg cggcggtgtt cgcggtgccg       360
     ctgggcatcg cgatgggcac ctggaagacg gtcgaggcct tcttcgagcc cttcgtgtcg       420
     ttctgccgct acctgccggc ctcggccttc attccgctgc tcatcttgtg ggcaggcctg       480
     ggcgagatgc agaagctgct ggtgatcttc atcggctcgt tcttccagat cgtgctgatg       540
     gtggccgtca ccgtgggcgg cgcgcggcgc gatctcgtcg aggccgccta cacgttgggc       600
     gccaacagcc gcggcatcgt cgcgcgggtg ctcattccgg gcgccgcgcc gggcatcgcc       660
     gaaacgctgc gcctcgtgct cggctgggcg tggacctacg tgatcgtcgc ggagctgatc       720
     ggctcgtcct cgggcatcgg ccacatgatc accgacagcc aggcgctcct gaacaccggg       780
     cagatcatct tcgggatcat cgtgatcggc gtcatcggcc ttctgtccga tttcgctttc       840
     aaggcgctca accgccgcct tttcgcatgg gccgcactgt ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page