(data stored in ACNUC1104 zone)

EMBL: CP002417.PE18

CP002417.PE18        Location/Qualifiers
FT   CDS_pept        complement(17865..19295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0018"
FT                   /product="Carotenoid oxygenase"
FT                   /note="PFAM: Carotenoid oxygenase; KEGG: bbt:BBta_5477
FT                   putative carotenoid oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34241"
FT                   /db_xref="GOA:E6UXP7"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP7"
FT                   /inference="protein motif:PFAM:PF03055"
FT                   /protein_id="ADU34241.1"
FT                   /translation="MNDVTLPRNAPPPNMAPIDFETELGPLPLQGVLPEGLRGTLVRNG
FT                   PNPVVPDPKAHWFAGDGMLHSFTLADGQVHYRNRWLRTDLWRAATEGRDLTSSFQKARV
FT                   SDGPPPQHDGTGNTNVIAHAGRLLALEEAHLPIGFELPTLATLGATDFDGALSGAFTAH
FT                   PKTDPRTGELLFFGYGTPAKLSNGMSFGVISPEGRVTRFEHFEAPYASMVHDFMATDRH
FT                   VMFPIMPLTASMERAQSGRPPYAWEPEYGTRVGLMPRDGSTADIVWWRGPSCYAFHVMN
FT                   AWEADGSLFADVMQFATPPLFPKPDGSPASEITPQSWLVRWQFDLSNPSREFTQTRISD
FT                   VPGEFPRIDDRFAGLPYRHGWYTCHAETTPGGPPRLYAGLAHIDHAKPGTERDMYMFPA
FT                   PEVVSEGVFVPRSPDAEEGDGWLLATVWRSATNTSDLVIFDARALAKGPVCTVSLPHRV
FT                   PVGFHGNWFGEEHTEERT"
     atgaacgacg tcaccctgcc tcgcaacgcc ccgccgccca acatggcgcc gatcgacttc        60
     gaaacggaac tcgggccgct gccgctgcaa ggcgtcttgc ccgaaggcct tcggggcacg       120
     ctggtgcgca acggcccgaa cccggtggtg cccgacccca aggcgcactg gttcgcgggc       180
     gacggcatgc tgcattcgtt caccctggcc gacgggcagg tgcactaccg caaccgctgg       240
     ctgcgcaccg atctctggcg cgccgccacc gaagggcggg acctgaccag cagcttccag       300
     aaggcgaggg tcagcgacgg accgccaccg cagcacgacg gcacgggcaa caccaacgtc       360
     atcgcccatg ccggccggct gctcgcgctc gaggaggcgc atctgccgat cggcttcgag       420
     ctgcccacgc tcgccaccct cggcgccacc gatttcgacg gcgcgctgag cggcgccttc       480
     accgcccacc cgaagaccga tccgcgcacc ggcgagttgc tgttcttcgg ctacggcacg       540
     ccggcgaagc tgtccaacgg catgagcttc ggcgtgatct cgcccgaggg ccgcgtcacg       600
     cgcttcgaac atttcgaggc gccctacgcc agcatggtcc acgacttcat ggcgaccgac       660
     cgccatgtga tgttccccat catgccgctc accgccagca tggagcgcgc ccagagcggc       720
     cgaccgccct acgcctggga acccgagtac ggcacccgcg tcggcctgat gccgcgcgac       780
     ggcagcacgg ccgacatcgt ctggtggcgc ggcccgagct gctatgcgtt ccacgtcatg       840
     aacgcctggg aggccgacgg cagcctgttc gccgacgtga tgcagttcgc gacgccgccc       900
     ctctttccga agcccgacgg ctcgcccgcc agcgagatca cgccgcagag ctggctggtg       960
     cgctggcagt tcgacctgtc gaacccgtcg cgcgaattca cgcagacgcg gatttcggac      1020
     gtcccgggcg aattcccgcg catcgacgac cgcttcgccg gcctgcccta ccgccacggc      1080
     tggtacacgt gccatgcgga aacgacgccc ggcgggccgc cgcgtctcta cgccggcctg      1140
     gctcacatcg accacgccaa acccgggacc gagcgcgaca tgtacatgtt ccccgcgccc      1200
     gaagtggtgt ccgaaggcgt tttcgtcccc cgctcgcccg atgcggaaga aggcgacggc      1260
     tggctgctcg cgaccgtgtg gcgcagcgcg accaacacca gcgacctcgt gatcttcgat      1320
     gcccgcgcgc tcgcgaaggg cccggtctgc acggtgtcgc tgccgcaccg cgtgccggtc      1380
     ggcttccatg gcaactggtt cggagaagaa cacacagaag agcgcacgtg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page