(data stored in SCRATCH zone)

EMBL: CP002417.PE183

CP002417.PE183       Location/Qualifiers
FT   CDS_pept        194567..196294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0184"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="TIGRFAM: urocanate hydratase; KEGG: vap:Vapar_0159
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34406"
FT                   /db_xref="GOA:E6V092"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:E6V092"
FT                   /inference="protein motif:TFAM:TIGR01228"
FT                   /protein_id="ADU34406.1"
FT                   /translation="MNAPEKFALNNPDAADPRHDPTRVIRAPRGSELNCKSWLTEAPFR
FT                   MLQNNLDAEVAERPQDLVVYGGIGRAARNWECYDQILASLKELNDDETLLIQSGKPVGV
FT                   FKTHENAPRVLLANSNLVPKWGTWEHFNELDRKGLFMYGQMTAGSWIYIGSQGIVQGTF
FT                   ETFVEAGRQHYNNSLAGKWILTAGLGGMGGAQPLAATLAGAVSLNIECQQSSIDFRLRT
FT                   RYVDKQARDIDHAFELIKQHCDAKEAVSIALLGNAADILPELVKRAKAGAHKPDLVTDQ
FT                   TSAHDLINGYLPSGWTVQQWQAAMKDVSQHDALKKAAAKSCAVHVQAMLDFQSMGIPTV
FT                   DYGNNIRQVAFDEGVKNAFDFPGFVPAYIRPLFCEGKGPFRWVALSGDPEDIYKTDAKI
FT                   KELFPENTHTHRWLDMARERIAFQGLPARICWLGLGERHIAGLAFNEMVKNGELKAPIV
FT                   IGRDHLDTGSVASPNRETEAMKDGTDAVSDWPLLNALLNTAGGATWVSLHHGGGVGMGY
FT                   SQHSGVVIVCDGTDAAAKRIERVLFNDPATGVMRHADAGYDIAIATAKKQGLKLPMVR"
     atgaacgctc ccgaaaaatt cgccttgaac aatcccgatg ccgccgaccc gcgccatgac        60
     ccgacgcgcg tgatccgcgc cccgcgcggc agcgaactca attgcaagag ctggctcacc       120
     gaagcgccgt tccgcatgct gcagaacaac cttgacgccg aggtggccga gcgtccgcaa       180
     gacctcgtgg tctacggcgg catcggccgc gccgcgcgca actgggagtg ctacgaccag       240
     atcctcgcgt cactgaaaga gctgaacgac gacgagacgc tgctcatcca gtcgggcaag       300
     cccgtgggcg tgttcaagac gcacgagaac gcaccgcgcg tgctgctcgc caattcgaac       360
     ctcgtgccca agtggggcac ctgggagcac ttcaacgagc tcgaccgcaa gggcctcttc       420
     atgtacggcc aaatgaccgc tggcagctgg atctacatcg gcagccaggg catcgtgcag       480
     ggcaccttcg agaccttcgt cgaagccggc cgccagcact acaacaacag cctcgcgggc       540
     aagtggatcc tcacggccgg cctcggcggc atgggcggcg cgcagccgct cgcggccacg       600
     ctcgcgggcg cggtgtcgct caacatcgag tgccagcagt cgagcatcga ctttcgcctg       660
     cgcacgcgct atgtcgacaa gcaggcgcgc gacatcgacc acgcgttcga actcatcaag       720
     cagcactgcg acgcgaagga agccgtgtcg atcgcgctgc tcggcaacgc ggccgacatc       780
     cttcccgaac tcgtgaagcg cgcaaaggcc ggtgcccaca agcccgacct cgtgaccgac       840
     cagacctccg cgcatgacct catcaacggc tacttgcctt cgggctggac cgtgcagcaa       900
     tggcaggccg cgatgaagga tgtctcgcag cacgacgcgc tcaagaaggc cgcggccaag       960
     tcgtgcgccg ttcacgtgca ggccatgctc gacttccagt ccatgggcat cccgaccgtc      1020
     gactacggca acaacatccg ccaggtcgcc ttcgacgagg gcgtgaagaa cgccttcgac      1080
     ttccccggct tcgtgcccgc ctacatccgc ccgctcttct gcgagggcaa ggggccgttc      1140
     cgctgggtcg cgctctcggg cgatccggaa gacatctaca agaccgacgc caagatcaag      1200
     gagctgttcc ccgagaacac gcacacgcac cgctggctcg acatggcgcg cgagcgcatc      1260
     gccttccagg gcctgcccgc gcgcatctgc tggctgggcc tgggcgagcg ccacatcgcg      1320
     ggcctggcct tcaacgagat ggtgaagaac ggcgaactga aggcgcccat cgtcatcggc      1380
     cgcgaccacc tggataccgg ctcggtcgcg agcccgaacc gtgagaccga agccatgaag      1440
     gacggcaccg atgcggtgag cgactggccg ctgctcaacg cgctgctcaa caccgcgggc      1500
     ggcgccacct gggtcagcct gcaccacggc ggcggcgtcg gcatgggcta ctcgcagcac      1560
     tcgggcgtgg tgatcgtgtg cgacggcacc gatgccgcgg ccaagcgcat cgagcgcgtg      1620
     ctcttcaacg acccggccac cggcgtcatg cgccacgccg atgcgggcta cgacatcgcc      1680
     atcgccaccg cgaagaagca gggcctgaag ctgccgatgg tgcgctga                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page