(data stored in SCRATCH zone)

EMBL: CP002417.PE185

CP002417.PE185       Location/Qualifiers
FT   CDS_pept        197192..197938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0186"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: vap:Vapar_0161 extracellular solute-binding
FT                   protein family 3; PFAM: extracellular solute-binding
FT                   protein family 3; SMART: extracellular solute-binding
FT                   protein family 3; ionotropic glutamate receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34408"
FT                   /db_xref="GOA:E6V094"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:E6V094"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADU34408.1"
FT                   /translation="MNTRRTLFTVAAAALFGFAGAAHAQGEPLRVATDATFPPMEFVEN
FT                   GKRTGFDVELVEAVGKTLGRKIEWIDIDFKGLVPGLISKRFDMAVSAIYITDERKKVVD
FT                   FTVPYYAGGLVVMVKDGNTAIKAPADINGKKVSVQVGTKSVAFTKEKYPQVQLMEVEKN
FT                   QEMFNLVDIGRADAAVTGKPAAYQYVRTRPGLKVLPEQITTEEYGMAIRKDTPELTKAV
FT                   NGAIEKLKADGTYAQIEKKWFSASAK"
     atgaacaccc gtcgcactct tttcaccgtt gccgccgccg ctctcttcgg tttcgccggc        60
     gccgcacatg cgcaaggcga gccgctgcgc gtggccaccg atgccacctt cccgccgatg       120
     gagttcgtgg agaacggcaa gcgcaccggc ttcgacgtgg aactggtcga ggccgtcggc       180
     aagacgctgg gccgcaagat cgaatggatc gacatcgact tcaagggcct cgtgccgggc       240
     ctgatttcca agcgcttcga catggccgtc tcggccatct acatcaccga cgagcgcaag       300
     aaggtcgtcg acttcaccgt gccgtactac gcgggcgggc tcgtcgtgat ggtgaaggac       360
     ggcaatacgg cgatcaaggc gccggccgac atcaacggca agaaggtcag cgtgcaggtg       420
     ggcaccaagt cggtcgcctt cacgaaggag aagtacccgc aggtgcagct gatggaagtc       480
     gagaagaacc aggaaatgtt caatctcgtg gacatcggcc gtgccgacgc cgccgtcacc       540
     ggcaagcccg ccgcttatca gtacgtgcgc acgcggccgg gcctgaaagt cctgcccgag       600
     cagatcacca ccgaggaata cggcatggcg atccgcaagg acacgcctga attgaccaag       660
     gcggtgaacg gcgccatcga aaaactcaag gccgacggca cctacgcgca gatcgaaaag       720
     aagtggttca gcgccagcgc caagtaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page