(data stored in ACNUC1104 zone)

EMBL: CP002417.PE186

CP002417.PE186       Location/Qualifiers
FT   CDS_pept        197946..198614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0187"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: vap:Vapar_0162 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34409"
FT                   /db_xref="GOA:E6V095"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V095"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADU34409.1"
FT                   /translation="MDLDFSPVWQGWPDLLRGALVTVEITACALALGCVLGLIVGIGRL
FT                   NPKRRWIYSVCTAYVAVIRGTPLLVQLFILFFGLPHFGILLPAFLCGVLGLGVYSGAYV
FT                   SEIVRGAIQSIDKGQTMAAQSLGMTPGVAMREIVLPQAVVRMIPPLGNEFIALIKNSAL
FT                   VSLLTIHDVMHEGQKIISVSYRSLEVYLAIALVYFVLTGTMTLVLRHFEQKLRQGGLMR
FT                   "
     atggatctcg atttctcgcc ggtctggcag ggctggcccg acctcttgcg cggtgcgctc        60
     gtcacggtgg agatcaccgc ctgcgcgctc gcgctgggct gcgtgctcgg cctcatcgtc       120
     ggcatcggcc ggctgaaccc gaagcgacgg tggatctaca gcgtgtgcac tgcttacgtg       180
     gcggtgattc gcggcacgcc gctgctggtg caactgttca tcctgttctt cggcttgccg       240
     cacttcggca tcctgctgcc cgcattcctc tgcggcgtgc tggggctcgg cgtgtactcg       300
     ggcgcgtatg tgtcggagat cgtgcgcggc gcgatccagt cgatcgacaa gggccagacg       360
     atggccgcgc agtcgctggg catgacgccc ggcgtcgcaa tgcgcgagat cgtgctcccg       420
     caggcggtgg tgcggatgat tccgccgctg ggcaacgagt tcatcgcgtt gatcaagaat       480
     tcggcgctgg tatcgctgtt gacgattcat gacgtgatgc acgaggggca gaagatcatc       540
     agcgtgtcgt accgctcgct ggaggtgtac ctggcgattg cgctcgtgta cttcgtgttg       600
     accggcacga tgacgctggt gctgcggcac ttcgagcaga agctgcggca aggcgggttg       660
     atgcgatga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page