(data stored in ACNUC1104 zone)

EMBL: CP002417.PE188

CP002417.PE188       Location/Qualifiers
FT   CDS_pept        199918..200490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0189"
FT                   /product="protein of unknown function DUF886"
FT                   /note="PFAM: protein of unknown function DUF886; KEGG:
FT                   vap:Vapar_0163 protein of unknown function DUF886"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34411"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6V097"
FT                   /inference="protein motif:PFAM:PF05962"
FT                   /protein_id="ADU34411.1"
FT                   /translation="MNDVHRFSRSSLPAMPWKNGGGTTQEIASWPQGAALDSFGWRVSI
FT                   ATIAAAGPFSVFPGIARSIMLLEGDGVRLFTHDGRVEHRLDVPHRPFAFSGEDAIDCTL
FT                   LGGASNDFNVMTRHGQWRADVQVLDRATAIEAAPHGVLLALRGAWRLNDERCTEGEGLH
FT                   WADASLAWQAAPESEDARLVAVRIVPA"
     atgaacgacg tgcatcgctt ctcgcgcagt tctctccccg ccatgccctg gaaaaacggc        60
     ggcggcacca cccaggaaat cgccagctgg ccgcagggcg ccgcgctcga cagcttcggc       120
     tggcgcgtga gcatcgccac catcgccgcc gcaggcccgt tctcggtgtt ccccggcata       180
     gcccgcagca tcatgctgct cgaaggcgac ggagtgcggc tcttcacgca cgacggacgc       240
     gtggagcacc ggctcgatgt gccgcaccgt ccgttcgcat tcagcggcga agacgcgatc       300
     gactgcacgc tgctgggcgg tgcatcgaac gatttcaacg tgatgacgcg gcacggtcag       360
     tggcgtgccg atgtgcaggt gctggaccgc gcaactgcca tcgaggccgc accgcacggc       420
     gtgctgctcg ctctgcgcgg cgcatggcgc ttgaacgacg agcgatgcac cgaaggcgag       480
     ggcctgcact gggccgacgc gtcgttggca tggcaagcag cgccggagag cgaagacgcg       540
     cggctggtgg ccgtacgcat cgtgccggcg taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page