(data stored in ACNUC1104 zone)

EMBL: CP002417.PE19

CP002417.PE19        Location/Qualifiers
FT   CDS_pept        complement(19406..20197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0019"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vap:Vapar_0018 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34242"
FT                   /db_xref="GOA:E6UXP8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP8"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU34242.1"
FT                   /translation="MSSMPSVADIEAIERATVAAVSPEASEELDGWLLPFDGGTVKRAR
FT                   SAVPLHRSAVDAGTLDRIEDRYDSRQVVPALRLADADCFDSLRAELERRHYVEDHPTCV
FT                   QIGTARQMRQVAAAGTGAGAGAGALADVDRAPDDAWAALFLGEGFDPVDGAHRVRALAR
FT                   AKGSLYASVRENGRTVAAGAMAFRHGWASVHGMRTDKAHRGRGLAGRVLAGLAQGALTK
FT                   GFERVFLQVDAQNHPALSLYRRAGFQTHWQYRYWQRQQWPR"
     atgagctcaa tgccgagcgt tgccgacatc gaagccatcg agcgcgccac cgtcgcggcg        60
     gtgtcgcccg aggcgtccga agaactcgac ggctggctgc tgcccttcga cggcggcacc       120
     gtcaagcgcg cgaggtcggc ggttcccctg caccgcagcg cggtggatgc cggcacgctg       180
     gatcgcatcg aggaccgcta cgacagccgc caggtcgtgc ccgcgctgcg gctggctgac       240
     gccgactgct tcgacagctt gcgggccgag ctggagcggc ggcactacgt cgaagaccac       300
     cccacctgcg tgcagatcgg aacggcgcgg cagatgcggc aggtcgcggc tgcgggaacc       360
     ggtgcgggtg cgggtgccgg cgcactggcc gatgtcgacc gcgcacccga cgacgcctgg       420
     gcggcgctgt tcctcggcga gggattcgat ccggtggacg gcgcgcatcg cgtgcgcgca       480
     ctggcccgcg ccaagggctc gctctatgcg agcgtgcgcg agaacggccg cacggtggcc       540
     gcgggcgcga tggctttcag acatggctgg gccagcgtgc acggcatgcg gaccgacaag       600
     gcgcaccggg gccggggcct cgcggggcgc gtgctggcgg ggctcgctca aggggcactg       660
     acgaaggggt tcgagcgcgt gttcctgcag gtcgatgcgc agaatcatcc ggcgctgtcg       720
     ctctatcggc gcgccggctt tcaaacgcat tggcaatacc gctactggca acgccagcag       780
     tggcctaggt aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page