(data stored in SCRATCH zone)

EMBL: CP002417.PE193

CP002417.PE193       Location/Qualifiers
FT   CDS_pept        205110..206159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0194"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   vap:Vapar_0167 homocysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34416"
FT                   /db_xref="GOA:E6V0A2"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A2"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ADU34416.1"
FT                   /translation="MKPLVYTRGQALAGILEKRIAILDGAMGTMIQRFKLTEEQYRGER
FT                   FKDFERDVKGNNELLSLTRPDVISDIHEGYLAAGADLIETNTFGATTIAQEDYKMAHLA
FT                   REMNLESARIARAACDKFSTPDKPRFVAGALGPTPKTASISPDVNDPGARNVDFEQLRA
FT                   AYYEQTEALVEGGADVILVETIFDTLNAKAALFAVDEYFDNSGERLPLIISGTVTDASG
FT                   RILSGQTVTAFWHSVRHARPLAIGLNCALGAALMRPYIQELARVAGDTFISCYPNAGLP
FT                   NPMSDTGFDETPDVTSRLLHEFAAEGLVNIVGGCCGTTPDHIAAIGRAVAPVPGRLLNN
FT                   TAGFYSEAA"
     atgaagcccc tcgtctacac ccgcggccag gccctggccg gcatcctcga aaagcgcatc        60
     gccatcctcg acggcgccat gggcacgatg atccagcgct tcaagctcac cgaggagcag       120
     taccgcggcg agcgcttcaa ggacttcgag cgcgatgtga agggcaacaa cgagctgctc       180
     tcgctcaccc ggcccgacgt catctccgac atccacgagg gctacctcgc ggcgggcgcc       240
     gacctcatcg agaccaacac cttcggcgcg accaccatcg cgcaggagga ctacaagatg       300
     gcgcacctgg cgcgcgagat gaacctcgaa tccgcccgca tcgcgcgcgc ggcctgcgac       360
     aagttcagca cgcccgacaa gccccgcttc gtggccggtg ccctcggccc gacacccaag       420
     acggcgagca tcagtcccga tgtgaacgac cccggcgcac gcaacgtcga tttcgagcaa       480
     ctgcgcgcgg cctactacga acagactgaa gcgctggtcg agggcggcgc cgacgtgatc       540
     ctggtcgaga ccatcttcga cacgctcaac gccaaggcag cgctgttcgc ggtggacgag       600
     tacttcgaca acagcggcga gcgcctgccg ctgatcatca gcggcacggt gaccgacgcc       660
     tcgggccgca tcctgagcgg ccagaccgtc accgcgttct ggcacagcgt gcggcatgcg       720
     cgcccgctgg ccattggcct gaactgcgcg ttgggcgcgg cgctgatgcg cccctacatc       780
     caggagctgg cgcgcgtggc gggcgacacc ttcatcagct gctacccgaa cgcgggcctg       840
     cccaatccga tgagcgacac cggcttcgac gagacgcccg atgtcacctc gcgcttgctg       900
     cacgagttcg cggccgaggg gctggtgaac atcgtgggcg gctgctgcgg cacgacgccg       960
     gaccacatcg cggcgatcgg ccgtgcggtg gcgccagtgc caggacgcct gctgaacaac      1020
     accgccggct tctacagcga agccgcctga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page