(data stored in ACNUC1104 zone)

EMBL: CP002417.PE195

CP002417.PE195       Location/Qualifiers
FT   CDS_pept        complement(206558..207478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0196"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: vap:Vapar_0169 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34418"
FT                   /db_xref="GOA:E6V0A4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A4"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADU34418.1"
FT                   /translation="MAFSSDNVEVFLAVIDHGSFSAAARALHKVPSAVSMAIAGLEAEL
FT                   NLPLFDRKGREPQPTAAARSLEPQARMLAAQLKQLQVQALALTQGLENRLTLAIAPELL
FT                   AAPWSGPLAELAQEYPLLQVEVLAAPQADALALLHSGRAQLALVFERPSLDGREGFQEV
FT                   GSDTMVAVMAPDHPALVAAAGERLREEHLTNTRQIVVAGRDLATSDPRFVFARHVWRTD
FT                   NALAALSLITAGLGWGWLPRNFARPHVAAGALIEIPFENLSNGLDLWVDVVWSRERPLG
FT                   LGAQRFVALIARDRQAAHAPKNVHP"
     atggcattct ccagcgacaa cgtcgaggtg ttcctggccg tgatcgacca cggctccttt        60
     tcagcggccg cgcgggcgct gcacaaggtg ccgtcggcgg tgagcatggc catcgccggc       120
     ctcgaagccg agttgaacct gcccctgttc gaccgcaagg gccgcgaacc gcaaccgacc       180
     gccgccgccc gttcgctgga gccacaggcg cgaatgctcg cggcgcaact caagcagttg       240
     caggtgcagg cgctcgcgct cacccagggg ctggaaaacc gcctgacgct cgccatcgcg       300
     cccgaactgc tggccgcgcc ctggagcggc ccgctcgctg aactcgcgca ggaatacccg       360
     ctgctgcagg tcgaagtgct ggccgcgcct caggccgacg cgctcgcgct gctgcacagc       420
     ggccgcgcgc aactggcgct ggtgttcgag cgcccgagcc tggacggccg cgaaggtttt       480
     caggaagtgg gcagcgacac gatggtggcc gtgatggcgc ccgaccaccc ggcactcgtc       540
     gcggcggctg gcgagcgcct gcgggaagag cacctcacga acacccggca gatcgtcgtg       600
     gccggccgcg acctggccac cagcgatccg cgcttcgtct tcgcgcgcca cgtctggcgc       660
     accgacaacg cgttggcggc actgagcttg atcaccgccg gtctcggctg gggctggctg       720
     ccgcgcaatt tcgcgcggcc gcacgtggcg gcgggcgcgc tgatcgagat tccgttcgag       780
     aacctcagca acgggctcga cctgtgggtc gatgtggtgt ggtcgaggga gcgcccgcta       840
     gggctgggcg cgcagcgctt cgtggcgctg atcgcgcggg atcggcaggc agcacatgcg       900
     ccgaaaaatg tgcatccctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page