(data stored in ACNUC1104 zone)

EMBL: CP002417.PE196

CP002417.PE196       Location/Qualifiers
FT   CDS_pept        207578..208051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0197"
FT                   /product="transmembrane pair domain-containing protein"
FT                   /note="PFAM: transmembrane pair domain-containing protein;
FT                   KEGG: vap:Vapar_0170 transmembrane pair domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34419"
FT                   /db_xref="GOA:E6V0A5"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A5"
FT                   /inference="protein motif:PFAM:PF05232"
FT                   /protein_id="ADU34419.1"
FT                   /translation="MQGLQRRVVYISLYEGIAIVCASAGLALMTDAGLGHSGVLAVAAS
FT                   VVAVIWNLIFNALFERWESRQAVRGRSVRRRIAHAIGFEGGLIAFLVPLFAWGLGVTLW
FT                   QALVMDLGLVLFFLVYTFVFNWGFDRVFGLPRSAQALPSAMPAPRSGASAPAR"
     atgcaagggc tccagcgtcg tgtcgtctac atctccctgt acgaagggat cgccatcgtc        60
     tgcgccagcg ccggcctggc cctgatgacg gacgcggggc tcggccattc cggcgtgctg       120
     gcggtggccg cgtcggtggt cgcggtgatc tggaacctga tcttcaacgc gctgttcgag       180
     cgctgggaat cgcgccaggc cgtgcgtggc cgcagcgtgc gccgccgcat cgcccacgcc       240
     atcggtttcg agggcgggct gatcgcgttc ctggtgcccc tgttcgcctg gggcctgggc       300
     gtgacgctct ggcaggcgct tgtgatggac ctgggtctgg tgctgttctt cctggtctac       360
     accttcgtct tcaactgggg cttcgaccgg gtgttcggcc tgccgcggtc ggcacaggcc       420
     ttgccgagcg caatgccagc gccccgctca ggcgcaagcg ctcccgctcg ttga             474
//

If you have problems or comments...

PBIL Back to PBIL home page