(data stored in SCRATCH zone)

EMBL: CP002417.PE198

CP002417.PE198       Location/Qualifiers
FT   CDS_pept        complement(208936..209973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0199"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: aav:Aave_4189 triacylglycerol lipase; PFAM:
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34421"
FT                   /db_xref="GOA:E6V0A7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A7"
FT                   /inference="protein motif:PRIAM:3.1.1.3"
FT                   /protein_id="ADU34421.1"
FT                   /translation="MPRKRNSRLLRLAARPVCAALLLGLVGTTTLSQAAITDTPTQVQA
FT                   RVTSSEAKTKNPIVLVHGLFGFDNVLGIDYFYRIPESLAGAGAKVYVAQVSGANSSEIR
FT                   GEQLIQELKNLRALSGNPSLKFNLVGHSQGAPTARYVAAVEPGLVASVTSVGGANGGSK
FT                   VADLLRKIPEGSVSEAVVAETLRLAMLLLGAISGKDPSQLPEVPLNALNSLTTAGGAAF
FT                   DKKFPQGRPAPGSSCDVKSGPAEANGVRYYSWSGVQPLTNAFDASDVAMGGLSLIAFGS
FT                   ETNDGLLAVCSTRLGTHLGDYRQNHLDEVNQLFGLTYIGLWTLFEKKPVQLYQEQAARL
FT                   KSAGL"
     atgccaagaa agaggaattc gaggctgctg cgcctcgccg cccgcccggt gtgcgccgca        60
     ctgcttctcg gtctggtggg gacgacaacg ctgagccagg cggccatcac cgacaccccc       120
     acgcaggtcc aggcccgggt gacgtccagc gaagcgaaga ccaagaaccc gatcgtgctc       180
     gtgcacggcc tcttcggttt cgacaacgtg ctgggcatcg actacttcta tcgcatcccc       240
     gagagcctgg ccggcgcggg cgcgaaggtg tacgtggccc aggtctcggg cgccaacagc       300
     tccgagatcc gcggcgagca gctgatccag gagctgaaga acctgcgggc gctctcgggc       360
     aacccgtcgc tcaagttcaa cctcgtcggt cattcgcagg gcgcccccac tgcgcgctac       420
     gtggcggcgg tggagcccgg gctggtcgcc tcggtcacct ccgtgggcgg ggccaatggc       480
     ggatcgaagg tggcggatct cttgcgcaag attcccgagg gcagcgtctc cgaggcggtg       540
     gttgcagaaa cgctgcggct cgcgatgctg ctgctcggcg ccatctcggg caaggacccg       600
     agccagctgc ccgaagtgcc gctgaacgcg ttgaactcgc tcaccaccgc gggcggcgcg       660
     gccttcgaca agaagtttcc gcagggccgc ccggcccccg gctcttcgtg cgacgtgaag       720
     agcggcccgg ccgaggcgaa cggcgtgcgc tactactcat ggtccggcgt gcagccgctc       780
     accaacgcgt tcgatgcgag cgacgtggcc atgggcgggc tgagccttat cgcgttcggg       840
     agcgagacca acgacggcct gctggccgtg tgctccacgc gcctgggcac gcacctgggc       900
     gactaccgcc agaaccacct ggacgaggtc aaccagctct tcggcctgac ctacatcggt       960
     ctgtggacgc tgttcgagaa gaagccggtg cagctctacc aggagcaggc cgcgcgactg      1020
     aagagcgcgg gcctctga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page