(data stored in SCRATCH zone)

EMBL: CP002417.PE2

CP002417.PE2         Location/Qualifiers
FT   CDS_pept        1556..2662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: vap:Vapar_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34225"
FT                   /db_xref="GOA:E6UXN1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN1"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADU34225.1"
FT                   /translation="MIVLKATQDKVLAALQSVSGIVERRHTLPILANVLIRKTGGQLQL
FT                   TTSDLEIQIRTTAELGGDEGNFTTTIGARKLIDILRTMPADQTVSLESSASKLVLKGGK
FT                   SRFTLQSLPAEDFPLVQEAANFGPVFSVPQKTLKDLLSQVSFAMAVHDIRYYLNGILFV
FT                   AEGKQLSLVATDGHRLAFSSAMLDVEVPRQEVILPRKTVLEMQRLLSDAEGAIEMQFAN
FT                   NQAKFSFGGMEFVTKLVEGKFPDYNRVIPKNHKNTVTLGRAPLLASLQRTAILTSEKFK
FT                   GVRLNIEPGTLRIASNNAEQEEAQDELDIDYGGDAIEIGFNVTYLIDALSNMDQDMVKL
FT                   DLADSNSSALLTIPENASFKYVVMPMRI"
     atgatcgttt tgaaggcaac ccaagacaag gttcttgcag cgctgcagtc ggtgtcgggc        60
     atcgtcgagc ggcgccacac gctgccgatc ctggcgaacg tgctgatccg caagaccggc       120
     ggccagctcc agctgaccac cagcgacctc gagatccaga tccgcaccac ggccgaactc       180
     ggcggcgacg aaggcaactt caccaccacc atcggcgcgc gcaagctcat cgacatcctg       240
     cgcaccatgc cggccgacca gaccgtgagc ctcgaatcga gcgcgagcaa gctggtgctc       300
     aagggcggca agagccgttt cacgctgcag tcgctgcccg ccgaagactt tccgctggtg       360
     caggaagccg ccaatttcgg ccccgtgttc agcgtgccgc aaaagacgct gaaggacctg       420
     ctctcgcagg tctcgttcgc gatggccgtg catgacatcc gctactacct gaacggcatc       480
     ctgttcgttg ccgaaggcaa gcaactgagc ctcgtggcca ccgacggcca ccgcctggcg       540
     ttctcctcgg ccatgctcga cgtcgaagtg cctcggcaag aagtgatcct tccgcgcaag       600
     acggtgctcg aaatgcagcg cctcctgtcc gacgccgaag gcgccatcga gatgcagttc       660
     gcgaacaacc aggccaagtt cagcttcggc ggcatggagt tcgtcaccaa gctggtcgag       720
     ggcaagttcc ccgactacaa ccgcgtgatc ccgaagaacc acaagaacac cgtcacgctc       780
     ggccgcgcgc cgctcctggc cagcctgcag cgcaccgcca tcctgaccag cgagaagttc       840
     aagggcgtgc gcctgaacat cgagcccggc acgctgcgca tcgcatcgaa caacgccgag       900
     caggaagaag cccaggacga gctcgacatc gactacggcg gcgacgccat cgagatcggc       960
     ttcaacgtca cctacctgat cgacgcgctg tccaacatgg accaggacat ggtcaagctg      1020
     gacctggccg actccaacag ctcggccttg ttaaccatcc ccgagaacgc atctttcaag      1080
     tacgtcgtga tgccgatgcg tatctag                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page