(data stored in SCRATCH zone)

EMBL: CP002417.PE201

CP002417.PE201       Location/Qualifiers
FT   CDS_pept        214845..215843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0202"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   vap:Vapar_0173 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34424"
FT                   /db_xref="GOA:E6V0B0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B0"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADU34424.1"
FT                   /translation="MNDVDHAADTVSRRSAAPRIAAVIPCFNEALAIRQVVEGFRASLP
FT                   ADAEIHVFDNNSTDDTAAVARAAGAIVTHVAAPGKGNVVRRMFADVEADIYVMVDGDAT
FT                   YETAAAPRLIQRLIDGNLDMVVGNRIDDGQNALTYRAGHRLGNRMLTGAVVQLFGGGLT
FT                   DMLSGYRVFSRRYAKSFPALSRGFEIETELTVHALELRMPWAEESTAYSTRPEGSHSKL
FT                   STYRDGWRILKTICKLFVSERPLQFFSIIAALLAAGAVALVVPLVVTYMHTGLVPRLPT
FT                   AVLATGAMLGAMLSMVCGVVMHAVTLGRREAKRLRYLAIPGVRNCSSNAPR"
     atgaacgacg ttgaccacgc cgccgacacc gtgagccgac gaagcgccgc gccgcgcatt        60
     gccgcggtga ttccgtgctt caacgaagcg ctggccatcc gccaggtggt cgagggcttc       120
     cgcgcctcgc tgccggcgga tgccgagatc cacgtgttcg acaacaactc gaccgacgac       180
     acggccgccg tcgcgcgcgc ggccggcgcc atcgtcacgc acgtggcggc gccgggcaaa       240
     ggcaacgtgg tgcggcgcat gttcgccgac gtggaggccg acatctacgt gatggtcgac       300
     ggcgacgcca cctacgagac cgccgccgcg ccgcgcctca tccagcggct gatcgacggc       360
     aacctggaca tggtggttgg caaccgcatc gacgacgggc agaacgcgct cacctaccgc       420
     gccggccacc gcctgggcaa ccgcatgctc accggcgcgg tggtgcagct ttttggcggc       480
     ggcctcaccg acatgctctc gggctaccgc gtgttctcgc ggcgctacgc gaagtcgttc       540
     ccggcgctgt cgcgcggttt cgagatcgag accgagctca ccgtgcacgc gctggaactg       600
     cgcatgccct gggccgagga aagcaccgcc tacagcacgc gtcccgaggg ttcgcacagc       660
     aagctctcca cctaccgcga cggctggcgc atcctgaaga ccatctgcaa gctcttcgtg       720
     agcgagcggc cgctgcagtt cttctcgatc attgcggcgc tgctcgcggc gggcgcggtc       780
     gcgctggtcg tgccgctcgt ggtcacctac atgcacaccg gcctggtgcc ccggctcccc       840
     acggcggtgc tggccaccgg cgcgatgctg ggtgcgatgc tgtcgatggt gtgcggcgtc       900
     gtgatgcacg cggtgacgct cggccgcagg gaggccaagc ggctgcgcta cctggcgatt       960
     cccggcgtgc gcaactgcag ctccaacgcg ccgcgatga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page