(data stored in ACNUC1104 zone)

EMBL: CP002417.PE202

CP002417.PE202       Location/Qualifiers
FT   CDS_pept        215840..216229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0203"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: vap:Vapar_0174 GtrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34425"
FT                   /db_xref="GOA:E6V0B1"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B1"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ADU34425.1"
FT                   /translation="MKLGREFLSFAVVGAAGFVVDVAVLYLTAPLLGWYGARVLSFLAA
FT                   ATATWALNRRYTFSARSANASVLREYLGYLVTMLGGAVVNYGAYVLVLHWVTGAWAPAA
FT                   GVALGSCAGLVVNFLSARYLVFRAR"
     atgaagctgg ggcgggagtt cctgtcgttt gccgtggtcg gcgcggcggg cttcgtggtc        60
     gatgtggcgg tgctgtacct gacggcgccg ctgctgggct ggtatggcgc acgggtgctg       120
     tccttcctgg cggccgctac cgcgacttgg gcactgaacc ggcgctatac gttcagcgcg       180
     cggagcgcca atgcctccgt actgcgcgaa tacctcggct atctcgtgac gatgctgggc       240
     ggcgccgtcg tcaactacgg cgcctatgtg ctcgtgctgc attgggtcac gggcgcctgg       300
     gcgccggcgg ccggcgtggc gctggggagc tgcgcggggc tggtggtgaa cttcctgtcc       360
     gcgcgctatc tggtgttcag ggccaggtag                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page