(data stored in ACNUC1104 zone)

EMBL: CP002417.PE206

CP002417.PE206       Location/Qualifiers
FT   CDS_pept        219419..221044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0207"
FT                   /product="6-hydroxynicotinate reductase"
FT                   /note="KEGG: vap:Vapar_0178 6-hydroxynicotinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34429"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B5"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0178"
FT                   /protein_id="ADU34429.1"
FT                   /translation="MTEHTKTDGLPGMDMPVVAEAGASAFGKAPPRNEKMSTAKVECNA
FT                   CPVLCQISDGRTGACDRYANREGVLVRVDPVVLLRREIASEAPTLVPFDRPAADKSEVI
FT                   EAGAPDWNGDLLHADEVFVTGVGSSTTYPDYKPAPFIVASKAQGVDMVTVVTEGIFSYC
FT                   SFKVKIDTDRFLGSEQANVRYRGEVVGHVTTAEYGSQMLSLGGVHHLTGGSKKEGRMTA
FT                   ELMQFLGNKKAVECTIDGGSTLVIQAGKAPIVNGVEEQRMRVGCGSAAVGIFARQFAGV
FT                   ADEVVVVDDHITGVLTEHQAGRCLDMAPSGIQMLGRKSTPGRYFQVANPGNGWGGTDIA
FT                   DPLAIIEGWEEGVARPGLRLLMTSTTGEHAQWYVLDDALKPVELEMPAEVKRIVDRIGE
FT                   NCEPSLCTVLFLGGAGGSLRAGVTENPVLLTRAIKRALVNVTCGGAPAYVWPGGGITVM
FT                   ADVMRMPDNSFGTVPTPAIVAPIEFSMRRADYEALGGHMEHIFSLEQALARGAWQEDGA
FT                   PLARQWLAMDAANPWPLGHAPMLG"
     atgaccgaac acaccaagac agacggattg cccggcatgg acatgccggt ggtcgccgaa        60
     gccggcgcca gcgctttcgg caaggcgccg ccgcgcaacg agaagatgag caccgccaag       120
     gtcgagtgca acgcgtgtcc ggtgctttgc cagatttccg acggccgcac cggcgcctgc       180
     gaccgctatg cgaaccgcga aggcgtgctg gtgcgcgtcg accccgtcgt gctgctgcgc       240
     cgagagatcg cgagcgaggc gcccacgctg gtgcccttcg atcgcccggc cgccgacaag       300
     agcgaagtga tcgaagcggg cgcccccgac tggaacggcg acctgctgca cgcagacgaa       360
     gtcttcgtta ccggcgtggg ctcgtccacc acctaccccg actacaaacc cgcccccttc       420
     atcgtggcct ccaaggccca gggcgtggac atggtcaccg tcgtcaccga aggcatcttc       480
     agctactgca gcttcaaggt gaagatcgac accgaccggt ttctgggctc cgagcaggcc       540
     aatgtgcgct accgcggcga ggtcgtgggc cacgtcacca cggccgaata cggctcgcag       600
     atgctgtcgc tcggcggcgt gcaccacctc accggcggca gcaagaagga aggccggatg       660
     acggccgagc tgatgcagtt cctgggcaac aagaaggcgg tggagtgcac catcgacggc       720
     ggctccacgc tcgtcattca ggctggcaag gcgcccatcg tcaacggcgt ggaagagcag       780
     cgcatgcgcg tgggctgcgg ctccgcggcg gtcggcatct tcgcgcgcca gttcgctggc       840
     gtggccgacg aggtggtggt ggtcgacgac cacatcaccg gcgtgctcac cgagcaccag       900
     gccggccggt gcctcgacat ggcgccctcg ggcatccaga tgctgggccg caagtccacg       960
     ccggggcgct acttccaggt ggcgaatccg ggcaacggct ggggcggcac cgacatcgcc      1020
     gatccgctcg cgatcatcga aggctgggaa gagggcgttg cgcgcccggg cctgcgattg      1080
     ctcatgacat cgaccaccgg cgaacacgct cagtggtatg tgctcgacga cgcgctgaag      1140
     cccgtcgaac tggagatgcc cgccgaagtg aagcgcatcg tcgaccgcat cggcgagaac      1200
     tgcgagccgt cgctgtgcac cgtgctgttc ctcggcggcg ccggtggcag cctgcgtgcc      1260
     ggcgtgaccg aaaaccctgt gctgctgacg cgcgccatca agcgcgcgct ggtcaacgtc      1320
     acctgcggcg gcgcgccggc ctacgtgtgg cccggcggcg gcatcaccgt gatggccgat      1380
     gtcatgcgca tgcccgacaa cagcttcggc accgtgccca cgccggccat cgtggcgccc      1440
     atcgaattca gcatgcggcg cgccgactac gaggcgctcg gcggccacat ggaacacatc      1500
     ttctcgctcg aacaggcgct cgcgcgcggt gcatggcagg aagacggcgc gccgctcgcg      1560
     cgccagtggc tcgcgatgga cgcagccaac ccgtggccgc tcggccacgc acccatgctg      1620
     ggctga                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page