(data stored in ACNUC1104 zone)

EMBL: CP002417.PE207

CP002417.PE207       Location/Qualifiers
FT   CDS_pept        221048..221956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0208"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: vap:Vapar_0179
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34430"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR007183"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B6"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ADU34430.1"
FT                   /translation="MSAQRSALDSSRWHFNHGPIDIVAEAHGDPYAVAAAHDAAWARFG
FT                   HVLDELVRELPLLRLPVTDKLRPRGVVGQRMWDACAAFSPMFITPMAAVAGSVAQELIA
FT                   FYDRPGIERAWINNGGDIAVHLAPGHSARVGVFADIARFDWRNHSNSILTTDGQFELHA
FT                   DEPVRGVATSGWRGRSFSLGIADSVTVLAATAAQADAAATVIANAVDVDDALIQRKPAS
FT                   ECKDDSDLGDALVTVDVPSLAPSQVKSALDTGAICAKVLQKGGLVWAALLVCQGQFRHV
FT                   EPLCSKSLQTVLPKSLGSVFA"
     atgtctgccc aacgcagcgc gcttgactcg agtcgctggc acttcaacca cggcccgatc        60
     gacatcgtgg ccgaggcgca cggcgatccg tacgccgtcg cggccgcgca cgacgcggct       120
     tgggcgcgct tcggccatgt gctcgacgag ctggtgcgcg agctgccgct cttgcgtttg       180
     ccggtgaccg acaagctgcg cccgcgcggc gtcgtcggtc agcgcatgtg ggacgcgtgc       240
     gccgcgttct cgccgatgtt catcaccccg atggcggccg tcgccggctc ggtggcgcag       300
     gagctcatcg cgttctacga ccgccccggc atcgagcgcg cctggatcaa caacggcggc       360
     gacatcgcgg tgcacctcgc acccggccac tcggcgcgcg tgggcgtgtt cgccgacatt       420
     gcgcgcttcg actggcgcaa ccacagcaac agcatcctca ccaccgacgg tcagttcgag       480
     ctgcatgccg acgagcccgt gcgcggcgtc gccaccagcg gctggcgtgg ccgcagtttc       540
     tcgctgggca tcgccgacag cgtgacggtc ctggccgcca ccgcagcaca ggccgatgcg       600
     gcggcgacag tgatcgccaa cgccgtcgat gtcgacgacg cgctcatcca gcgcaagccc       660
     gccagcgaat gcaaggacga cagcgacctg ggcgacgcct tggtcaccgt cgacgtgccg       720
     tcgctcgcac catcacaggt gaaaagcgca ctcgatacgg gcgcgatctg cgccaaggtc       780
     ctgcaaaaag gagggctcgt ctgggccgct ctactcgttt gccaggggca gttccgacat       840
     gtcgagccct tatgctcgaa gtcgctgcag accgtgctgc cgaaatcact tggttcagta       900
     tttgcttaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page