(data stored in SCRATCH zone)

EMBL: CP002417.PE209

CP002417.PE209       Location/Qualifiers
FT   CDS_pept        222658..223242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0210"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="PFAM: protein of unknown function DUF1185; KEGG:
FT                   vap:Vapar_0181 protein of unknown function DUF1185"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34432"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B8"
FT                   /inference="protein motif:PFAM:PF06684"
FT                   /protein_id="ADU34432.1"
FT                   /translation="MTANIRKLVIQVDEVRKEMGQDVTPPTRRAVAIAVIENPYAGRYS
FT                   ENLDELIAIGEELGALLGQKAVKALGIEPGQAQSYGKAAIVGERGELEHAAAILHPKLG
FT                   APLRVAVEKGAALVPSAKKQGTLGTAIDVPLGHKDAAFVRSHFDAIEARVSDAPRANEI
FT                   VVAVAVTDSGRPLPRIGGLQASEIKGEDGLR"
     atgaccgcca acatccgcaa gctcgtcatc caagtcgatg aagtccgcaa ggaaatgggg        60
     caggacgtga cgccgcccac ccgccgcgcc gtcgccattg ccgtgatcga gaacccctac       120
     gccggccgct acagcgagaa cctcgacgag ctcatcgcca tcggcgagga gctcggcgcg       180
     ctgctcggcc agaaggccgt gaaggcgctc ggcatcgagc ccggccaggc gcagagctac       240
     ggcaaggccg ccatcgtcgg cgagcgcggc gagctcgaac atgcggccgc gatcctgcac       300
     cccaagctcg gcgcgccgct gcgcgtggcg gtcgagaagg gcgcggcgct cgtgccttcg       360
     gccaagaagc agggcacgct cggcaccgcc atcgacgtgc cgctcggcca taaagacgcc       420
     gccttcgtgc gcagccattt cgacgccatc gaggcccgcg tgtccgatgc gcctcgcgcc       480
     aacgagatcg tcgtcgccgt ggccgtcacc gacagcggcc gtccgctgcc gcgcatcggc       540
     ggtctgcaag ccagcgaaat caagggcgaa gacggcctgc gctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page