(data stored in ACNUC1104 zone)

EMBL: CP002417.PE213

CP002417.PE213       Location/Qualifiers
FT   CDS_pept        227320..228054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0214"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0186 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34436"
FT                   /db_xref="GOA:E6V0C2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0C2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34436.1"
FT                   /translation="MSTHEPLLQAKALCAWYGAAQILYDVDLDVRRGEVVALMGRNGAG
FT                   KSTTLKALIGMLAKRRGAVRFLGHDISKSEPHHAARLGLGFVPEDRRVFTDLTVMENLE
FT                   VGKQPARQWADGTEAPLWTPERLFKLFPNLGEMPNRPGGRMSGGEQQMLTVARTLMGNP
FT                   YLVLLDEPSEGVAPVIVEQMANMILELKAQGVSILLSEQNMHFAELVSDRAYVLEKGQI
FT                   RYHATMAELSANEEVRRAYLSV"
     atgagcacgc acgaacctct tcttcaagcg aaggcgttgt gcgcctggta cggcgccgcg        60
     cagattcttt atgacgttga cctcgacgtg cgccgaggcg aagtcgtcgc gctcatgggc       120
     cgcaacggcg caggcaagtc gaccacgctg aaggcgctga tcggcatgct tgccaagcgc       180
     cgcggcgcgg tgcgcttcct cggccacgac atctccaaga gcgagccgca ccacgcggcg       240
     cgcctgggcc tgggtttcgt gcccgaagac cggcgcgtgt tcactgacct cacggtgatg       300
     gagaacctcg aagtcggcaa gcagcccgca cgccaatggg ccgacggcac cgaggcgccg       360
     ctgtggacgc ccgagcgcct gttcaagctc tttcccaatc tcggcgaaat gcccaaccgc       420
     cccggcggtc gcatgagcgg cggcgagcag cagatgctga cggtcgcgcg cacgctgatg       480
     ggcaacccct acctcgtgct gctcgacgag ccgtccgaag gcgtggcgcc cgtcatcgtc       540
     gaacagatgg ccaacatgat cctggaactc aaggcgcagg gcgtgagcat cctcctgtcg       600
     gagcagaaca tgcacttcgc cgagctcgtg tccgaccggg cctatgtgct cgagaagggc       660
     cagatccgtt atcacgccac gatggccgaa ctttctgcca acgaagaagt gcgccgcgcg       720
     tatctcagcg tttga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page