(data stored in ACNUC1104 zone)

EMBL: CP002417.PE215

CP002417.PE215       Location/Qualifiers
FT   CDS_pept        228900..230033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0216"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vap:Vapar_0188 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34438"
FT                   /db_xref="GOA:E6V0C4"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0C4"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34438.1"
FT                   /translation="MVAGGAALALGPGLLRSARAENGVTDTTIRIGQSAVFSGPAKDFG
FT                   VDYRAGIKLYFDRVNKSGGINGRKIELVTYDDAYDPAKTAVNTAKLIDEDKVFALTGFV
FT                   ATGNLAAAMPLAEKAGVPMFAPLVGTTSFRTKVNRYLFHVRAGYDLELRKIISHLSTIG
FT                   ISSIAVVFQDSPFGKSNLATCEQLAAEYKVQVVKTLPLAITAEDAKQVATEISAAKPGA
FT                   VVMIMAGRMVETFIRDYRAGGVGAPLYTLSVGITDAAGSAKRLDGKLAGLVTASIVPPP
FT                   QAQRVPIVADYQRDRAEFGEKIDSYTTLEGYIVARVMVEGLRRAGKTLTRDSFIAGLES
FT                   IGSTRFGDFPIDYSAKNHNGSTFVDLEMYTRDGQLRR"
     atggtggcgg gcggcgcagc cctggcattg ggcccgggcc ttctccggtc ggcacgcgca        60
     gagaacggcg tgaccgacac caccatccgc atcggccagt cagccgtgtt cagcgggccg       120
     gcgaaagact tcggcgtcga ctaccgcgcg ggcatcaagc tctacttcga ccgcgtcaac       180
     aaatcgggcg gcatcaacgg ccgcaagatc gaactcgtca cgtacgacga tgcctacgac       240
     cccgcgaaga cggcggtgaa cacggccaag ctgatcgacg aggacaaggt cttcgcgctc       300
     accggcttcg tggccaccgg caacctcgcg gcggcgatgc cgctcgccga gaaggcgggc       360
     gtgccgatgt tcgcgccgct ggtgggcacc acctcgttcc gcaccaaggt caaccgttac       420
     ctgttccatg tgcgtgccgg ctacgacctg gagctgcgca agatcatcag ccacctctcg       480
     accatcggca tctcgtcgat cgcggtggtg ttccaggaca gccccttcgg caagtcgaac       540
     ctcgccacct gcgagcagct cgcggccgag tacaaggtgc aggtggtcaa gacgctgccg       600
     ctggccatca ccgcggaaga cgcgaaacag gtcgccaccg agatctctgc ggccaagccc       660
     ggcgcggtcg tgatgatcat ggccggccgc atggtcgaaa ccttcattcg cgactaccgc       720
     gcgggtggcg tgggtgcgcc gctgtacacg ctgtcggtcg gcatcaccga tgcggccggc       780
     tcggccaagc ggctcgacgg caagctcgcg ggcctggtca ccgccagcat cgtgccgccg       840
     ccgcaggcgc agcgcgtgcc catcgtggcc gactaccagc gcgaccgcgc cgagttcggc       900
     gagaagatcg acagctacac cacgctggag ggctacatcg tcgcgcgcgt gatggtcgaa       960
     ggcctgcgcc gcgcgggcaa gacgctcacg cgcgacagct tcatcgccgg gctcgagagc      1020
     atcggcagca cgcgcttcgg cgatttcccc atcgactaca gcgcgaagaa ccacaacggc      1080
     tcgaccttcg tggacctgga gatgtacacc cgtgacggcc agttgcggcg ctga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page