(data stored in ACNUC1104 zone)

EMBL: CP002417.PE216

CP002417.PE216       Location/Qualifiers
FT   CDS_pept        230011..230511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0217"
FT                   /product="(2Fe-2S)-binding domain-containing protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain-containing protein;
FT                   ferredoxin; KEGG: vap:Vapar_0189 (2Fe-2S)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34439"
FT                   /db_xref="GOA:E6V0C5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0C5"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ADU34439.1"
FT                   /translation="MTASCGAEPLHLQVNGQAQSLAGVPREASLLHFLRNDLGLNGPKY
FT                   GCGLGQCGACTVHVDGVAARSCVIPAHGVAGRAITTLEGLGMRGRWHPVQAAFQEAQAA
FT                   QCGYCLNGMVMQAAALLARDPHASEARIRSELSGNLCRCGTHIEILDAVQRAAARMSAK
FT                   VNP"
     gtgacggcca gttgcggcgc tgagccgctg cacctgcagg tcaacgggca ggcgcagtcg        60
     ctcgcgggtg ttccccgcga ggcgtcgctg ctgcactttc tgcgcaacga cctcgggctc       120
     aacgggccga agtacggatg cgggttgggg cagtgcggtg cgtgcacggt gcatgtcgat       180
     ggcgtggccg cgcggtcgtg cgtgattccc gcgcacggcg tcgcgggtcg cgcgatcacc       240
     acgctcgagg gcctcggcat gcgcggtcgc tggcacccgg tgcaggccgc cttccaagag       300
     gcgcaggccg cgcagtgcgg ctattgcctc aacggcatgg tgatgcaggc ggcggcgctg       360
     ctcgcgcgcg atccgcatgc aagcgaagcg cgcatccgca gcgaactgtc gggcaacctg       420
     tgccgctgcg gcacgcacat tgaaatcctc gatgccgtgc agcgcgcggc cgcgcgcatg       480
     agcgcaaagg tgaatccatg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page