(data stored in ACNUC1104 zone)

EMBL: CP002417.PE22

CP002417.PE22        Location/Qualifiers
FT   CDS_pept        complement(22023..22952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0022"
FT                   /product="Exosortase EpsH-related protein"
FT                   /note="PFAM: Exosortase EpsH-related; KEGG: vap:Vapar_0021
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34245"
FT                   /db_xref="GOA:E6UXQ1"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ1"
FT                   /inference="protein motif:PFAM:PF09721"
FT                   /protein_id="ADU34245.1"
FT                   /translation="MSLATLAHRHPRIVDWGIHIDRTPAAGWLGLQFAALAPTWAWMVQ
FT                   RMRDGSDDPLGLVALVALAALAWQCRRELRASPRLGWLALAGAGTVLATVLRSGLGVVP
FT                   ALPPLAAGLVAVLALACGLLAFLPRRVAALPVTGLAVLALPLLSSLQFYAGYPLRVVTA
FT                   EASRWLLAPGFDVAREGTSLMVDGRLVIVDAPCSGVQMVWLGYFTACAVALWARRSDKA
FT                   FLRRLPMVGVLVLAGNVVRNSVLIAFEGAGHALAPWAHNALGLVVLAAVCGCIGRLMVP
FT                   ARAVPEPADHPVPGLITTQGARHVDTVL"
     atgtctctgg caacgctcgc ccaccgtcat ccgcgcatcg tggattgggg cattcacatc        60
     gaccgcacgc cggccgccgg ctggctcggg ctgcagttcg ccgcgctcgc gcccacctgg       120
     gcgtggatgg tccagcgtat gcgcgacggc tccgacgatc cgctgggcct cgtggcattg       180
     gtcgcactgg ctgcattggc ctggcaatgc cggcgtgagt tgcgcgcatc cccgcgactg       240
     ggctggctgg cgctcgcggg ggcaggcacc gtgctcgcca cggtactgcg ctcggggctc       300
     ggcgtcgtgc cggcgctgcc gccgctggca gcgggactgg tggcggtgct ggcactggcc       360
     tgcggcctgc tggcttttct gccgaggcgc gtcgccgcgc tgccggtgac gggtctcgcg       420
     gtgctcgcgc tgccgctgtt gtcatcgctg cagttctacg ccggctatcc gctgcgcgtg       480
     gtgacggccg aggccagccg ctggctgctc gcgccgggct tcgacgtggc gcgcgaaggc       540
     acgagcctga tggtggatgg ccgcctggtg atcgtcgatg cgccctgctc cggcgtgcag       600
     atggtgtggc tgggctactt caccgcctgt gccgtcgcgc tgtgggcgcg ccgcagcgac       660
     aaggcgttcc tgcggcgcct gccgatggtc ggcgtgctgg tactggccgg aaacgtcgtg       720
     cgcaacagcg tgctgatcgc tttcgaaggc gcgggccacg cgctggcgcc gtgggcgcac       780
     aacgcgctgg gcctcgtcgt gctggcggcc gtgtgcggct gcatcggccg cctgatggtg       840
     cctgcgcgcg ccgtgccgga acccgccgac caccccgttc cgggcctgat caccacgcaa       900
     ggagcccgcc atgtcgacac cgttctttga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page