(data stored in ACNUC1104 zone)

EMBL: CP002417.PE221

CP002417.PE221       Location/Qualifiers
FT   CDS_pept        238449..238787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0222"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   vap:Vapar_0218 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34444"
FT                   /db_xref="GOA:E6V180"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:E6V180"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADU34444.1"
FT                   /translation="MKLVTAIIKPFKLDEVREALSAIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVSDDLVDRVIEAVEGAARTGKIGDGKIFVYNLEQVVRIRT
FT                   GETGREAL"
     atgaagctgg tcacagccat catcaaaccg ttcaagctcg acgaagtgcg tgaagcactg        60
     tcggcgatcg gcgtgcaggg gatcaccgtc accgaggtga agggcttcgg ccgccagaag       120
     ggccacaccg agctctaccg cggcgcggag tacgtggtcg acttcctgcc caaggtcaag       180
     atcgaagcgg ccgtctccga cgacctggtc gatcgcgtga tcgaagccgt cgaaggtgcc       240
     gcccgcaccg gcaagatcgg cgacggaaag atctttgtct acaacctcga gcaggtcgta       300
     cgcatccgca ccggcgaaac gggccgcgaa gccctctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page