(data stored in SCRATCH zone)

EMBL: CP002417.PE223

CP002417.PE223       Location/Qualifiers
FT   CDS_pept        240550..241482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0224"
FT                   /product="SMP-30/Gluconolaconase/LRE-like region-containing
FT                   protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE-like
FT                   region-containing protein; KEGG: vap:Vapar_0220
FT                   SMP-30/gluconolaconase/LRE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34446"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:E6V182"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ADU34446.1"
FT                   /translation="MWTSLDNSLCELGESPFWHPEERSLYWLDIPGRAVLRTRGDIGTT
FT                   SATVERWALSTEPGCMAPARSGGLVIALRDGIYRAREWGGELVAMARVEHDVRTMRFND
FT                   GKCDPLGRFWGGSLNEAKDRANAALYCFDARPGTDISPTLSQMANESTTANGLSFSPDA
FT                   RTLYWADTAAHVVCAWDWDAEANALSRARVFHQFDAKPEGWTPDSPVRYEGRPDGATVD
FT                   AEGHYWVAMFEGAQLLRFAPSGEIVASVPVPLQCPTMPCFGGDDLKTLFVTSGRKGRPA
FT                   AEIERLPASGTVISTRVDTPGLPVSFFED"
     atgtggacct ccctcgacaa cagcctctgc gagctcggcg aatcgccgtt ctggcaccct        60
     gaagaacgct ccctctattg gctcgacatc cctggccgcg ccgtgttgcg aacgcgcggc       120
     gacatcggaa cgacaagtgc cacggtcgag cgatgggccc tctccaccga acccggctgc       180
     atggcgccgg cccgaagcgg cggcctcgtg atcgcactgc gcgacggcat ctaccgcgcg       240
     cgcgaatggg gcggtgaact ggtcgcgatg gcgcgcgtcg agcacgacgt gcgcaccatg       300
     cgtttcaacg acggcaaatg cgatccgctc gggcgcttct ggggcggttc gctcaacgag       360
     gcgaaagacc gcgccaacgc cgcgctctac tgcttcgatg cacgccctgg caccgacatt       420
     tcgcccacgc tttcgcagat ggccaacgag tccaccaccg ccaacggcct ctcgttctcc       480
     cccgacgcgc gcactctcta ctgggccgac accgccgcgc acgtggtctg tgcatgggac       540
     tgggatgccg aggccaacgc gctctcgcgc gcccgcgtgt tccaccagtt cgacgccaag       600
     cccgaaggct ggacacccga ctcgccggtt cgctacgaag gccggcccga tggcgcgacg       660
     gtcgatgccg aagggcacta ctgggtcgcg atgttcgaag gcgcgcagct gctgcgcttc       720
     gcgccgtccg gtgaaatcgt ggcctcggtg ccggtccctc ttcaatgccc gaccatgcct       780
     tgtttcggcg gcgatgacct caagacgctc ttcgtcacca gcggccgcaa aggccggcct       840
     gctgcggaga tcgaacgact tccggcatcg ggcacggtga tctcgacgcg cgtcgatacg       900
     cccgggctgc cggtcagttt tttcgaggac tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page