(data stored in ACNUC1104 zone)

EMBL: CP002417.PE229

CP002417.PE229       Location/Qualifiers
FT   CDS_pept        complement(247210..247698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0230"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: vap:Vapar_0226 peroxiredoxin; PFAM:
FT                   glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34452"
FT                   /db_xref="GOA:E6V188"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6V188"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ADU34452.1"
FT                   /translation="MTSVYDFEANQIDGKPVKLSAFKGKVLLIVNTASKCGFTPQFAGL
FT                   EALHEKYADQGLAVLGFPSNQFGSQDPGTNEEIGAFCTKNYGVSFPMMEKIDVNGSNAA
FT                   PLYQWLTKEKPGLLGLTAIKWNFTKFLIGRDGTVLKRYAPLDTPASLTRDVEAALAAG"
     atgaccagcg tctacgactt cgaggccaac cagatcgacg gcaagcccgt gaagctttcc        60
     gccttcaagg gcaaggtgct gctgatcgtc aacacggcga gcaaatgcgg gttcacgccg       120
     cagttcgccg ggctcgaagc gttgcacgag aagtacgccg accagggcct cgcggtgctg       180
     ggttttccgt cgaaccagtt cggctcgcag gacccgggca ccaacgagga aatcggcgcg       240
     ttctgcacca agaactacgg cgtgagtttt ccgatgatgg agaagatcga cgtcaacggc       300
     agcaacgccg cgccgctcta ccagtggctc accaaagaga agccgggcct cctgggcctc       360
     accgccatca agtggaactt caccaagttc ctcatcgggc gcgatggcac ggtgctcaag       420
     cgctatgcgc cgctcgacac gcccgcctcg ctcacgcgcg acgtcgaggc ggcgctcgca       480
     gcgggctga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page