(data stored in ACNUC1104 zone)

EMBL: CP002417.PE230

CP002417.PE230       Location/Qualifiers
FT   CDS_pept        complement(247710..248600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0231"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: vap:Vapar_0227 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34453"
FT                   /db_xref="GOA:E6V189"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6V189"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADU34453.1"
FT                   /translation="MPALALIFNAFVWGLSWFPFRHIESHGLHPLWTTCLIYLAIATVM
FT                   GIVRRHAWKSFTAYPMLAVLGLAAGFTNVGFNWAVTQGDVVRVVLLFYLMPLWSVLLGW
FT                   LLLGERPTGGALARVALALTGVVVVLKAPGTDWPVPSSLPDWLGLAAGFSFAVTNIVLR
FT                   HLRPAPGESRALAMFCGCTFVAGIAALVGTSLGAIASPLQATPGWLGWAVLLGAGFVIG
FT                   NVCLQYGAARLAASATSVIMLSEVLFASVSSVALGASTMDPRILTGGALIVLGAVWAAF
FT                   ARTPARGDDRASAST"
     atgcccgccc tcgcgctgat cttcaatgcc ttcgtctggg ggctgtcgtg gtttcccttc        60
     cggcacatcg aaagccacgg cctgcacccg ctgtggacca cctgcctcat ctacctggcc       120
     atcgcgacgg tgatggggat cgtgcgccgt catgcctgga agagcttcac ggcctacccg       180
     atgctcgcgg tgctgggcct tgcggcgggc ttcaccaacg tgggtttcaa ctgggcggta       240
     acgcagggcg acgtcgtgcg cgtggtgctg ctgttctatc tgatgccgct ctggagcgtg       300
     ctgctgggct ggctgctgct gggcgagcgg cccacgggcg gcgcgctcgc gcgcgtggcg       360
     ctggcgctca ccggggtggt cgtggtgctc aaggcgccgg gcaccgactg gccagtgccg       420
     tcgagcctgc ccgactggct gggcttggcg gccggcttca gcttcgcggt gaccaacatc       480
     gtgctgcgcc acctgcggcc cgcgccgggc gaatcgcgtg cgctcgcgat gttctgcggc       540
     tgcaccttcg tggcgggcat cgcggcgctg gtcggcacct cgctcggcgc cattgcttcg       600
     cctctgcagg ccacgccggg ctggctcggc tgggccgtgc tgctgggtgc gggtttcgtg       660
     atcggcaacg tgtgtcttca atacggcgcg gcacggctcg cggccagcgc gacctcggtg       720
     atcatgctgt cggaagtgct gttcgccagc gtctcgtcgg tggcgctcgg cgcctccacg       780
     atggacccgc gcatcctcac gggcggcgcg ctgatcgtgc tgggcgccgt ctgggccgcg       840
     tttgcacgaa cgccggcccg gggcgatgat cgcgcctctg cgtccacctg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page