(data stored in ACNUC1104 zone)

EMBL: CP002417.PE231

CP002417.PE231       Location/Qualifiers
FT   CDS_pept        complement(248671..249975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0232"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vap:Vapar_0228 lysophospholipid transporter LplT"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34454"
FT                   /db_xref="GOA:E6V190"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6V190"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU34454.1"
FT                   /translation="MKRGFYTIMSAQFFSSLADQALFVVAVDLMRSSGAPEWQRAALVP
FT                   IFAVFYVVLAPLVGAFADALPKGKVMFISNAIKVIGCLMMLFGSHPLLSYSIVGLGAAA
FT                   YSPAKYGILTELLPASQLVKANGWIEGLTIASILLGIVLGGTLVGHAVSSHLLAFDFPL
FT                   IDTGIDSPAEAAISVLILVYMLAAWFNTRIPHTGVEMRPLRSNPEHGFARNLAALLPDF
FT                   WHCNARLWRDRLGQISLATTTLFWGAGGNLKYIVLAWASLALGYNTTQASALTGVVTIG
FT                   TAVGAIVASMRMRLDMATRVIPMGIAMGLMVICMNFIGNVWLAVPFLIILGGLGGFLVV
FT                   PMNALLQHRGHNLMGAGRSIAVQNFNEQACILLLGGFYSVCTGLGLSAYGAISAFGLVV
FT                   AGCMWLIKRWHENNLKKYPEEVEHLLAIARSDKHH"
     atgaagcgcg gtttctacac gatcatgtcg gcccagttct tttcgtcgct ggccgaccaa        60
     gcgcttttcg ttgttgccgt cgatctcatg cgaagttcgg gcgcgcccga atggcagcgc       120
     gcggcactgg tgccgatctt cgcagtcttc tatgtggtgc ttgcgccgct ggtgggcgcg       180
     tttgcagacg cgctgcccaa gggcaaggtg atgttcatca gcaacgcgat caaggtgatc       240
     ggctgcctga tgatgctgtt cggctcgcac cccctgttgt cgtattcgat cgtgggcctg       300
     ggcgcggcgg cctactcgcc ggccaagtac ggcatcctca ccgaactgct gcccgcctcg       360
     caactggtca aggccaacgg ctggatcgag ggcctcacca tcgcctccat cctcctgggc       420
     atcgtgctgg gcggcacgct cgtgggccat gcggtctcca gccacttgct ggccttcgac       480
     ttcccgctga tcgacaccgg catcgattcc cccgccgagg ccgcgatctc ggtgctgatc       540
     ctggtctaca tgctggccgc ctggttcaac acgcgcatcc cgcacaccgg cgtcgagatg       600
     cgcccgttgc gctccaaccc cgagcacggc ttcgcacgca acctcgccgc gctgctgccc       660
     gacttctggc attgcaatgc gcgcctgtgg cgcgaccgcc tcggccagat ctcgctggcc       720
     accaccacgc tcttctgggg cgcgggcggc aacctcaagt acatcgtgct ggcgtgggct       780
     tcgctcgcgc tgggctacaa cacgacgcag gcctcggcgc tcactggcgt ggtgaccatc       840
     ggcacggccg tgggcgccat cgtggcctcg atgcgcatgc ggctggacat ggccacccgc       900
     gtgatcccga tgggcatcgc gatgggtctc atggtcatct gcatgaactt catcggcaac       960
     gtgtggctcg cggtgccgtt cctcatcatc ctgggcggcc ttggcggctt cctggtggtg      1020
     ccgatgaatg cgctcttgca gcaccgcggc cacaacctca tgggcgcggg ccgttcgatt      1080
     gccgtgcaga acttcaacga gcaggcctgc atccttctgc tgggcggctt ctacagcgtg      1140
     tgcaccgggc tgggcctgtc ggcctacggt gcgatcagcg ccttcggcct cgtggtggcg      1200
     ggctgcatgt ggctcatcaa gcgctggcac gagaacaacc tgaagaagta cccggaagaa      1260
     gtcgagcatc tgctggccat cgcccgcagc gacaaacacc actga                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page