(data stored in SCRATCH zone)

EMBL: CP002417.PE233

CP002417.PE233       Location/Qualifiers
FT   CDS_pept        251266..252015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34456"
FT                   /db_xref="GOA:E6V192"
FT                   /db_xref="UniProtKB/TrEMBL:E6V192"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0230"
FT                   /protein_id="ADU34456.1"
FT                   /translation="MKILSNWRSVRLWETEVERDLHRNHSLRTHGILIGTFTLLLMWGV
FT                   SALQMHLLHVDSLAVRYFLTLGVGYLGYLLVLRWWARRLVEDGVGANLDMGAGDAVDAG
FT                   EFALDVAGSVGRASRASGVGDAADMAGGALELAGASDEGAIIVVPVVAIFLICVAVLFG
FT                   VGSLVLLYFSWDALLAVAIEVAFSYVSARAAVRVAREGWLMAAVRLTWKPLLGALISAV
FT                   ILGALLDHFMPQVNSLPEAVRVLLKTN"
     atgaagatcc tttccaactg gcgctcggtg cgcctttggg aaacggaggt cgagcgcgac        60
     ctgcaccgca accacagcct gcgcacgcac ggcatcctga tcggcacgtt cacgctcctc       120
     ctgatgtggg gcgtgtcggc gctacagatg cacctgctgc atgtggactc gctggcggtg       180
     cgctacttcc tcacgctggg cgtgggctac ctcggctact tgctcgtgct gcgctggtgg       240
     gcccggcggc tggtggagga cggcgttggc gccaacctgg acatgggcgc cggcgacgcg       300
     gtggatgccg gtgaattcgc tttggacgtt gccggcagcg taggccgtgc cagccgcgcg       360
     agcggtgtcg gcgatgccgc cgacatggcg ggcggtgcgc tggaactcgc gggcgcttcc       420
     gacgaaggcg cgatcatcgt cgtgccggtg gtcgccatct tcctgatctg cgtggccgtg       480
     ctgttcggcg tcggctcgct cgtgctgctg tatttcagct gggacgcgct gctggccgtg       540
     gcgatcgagg tggcgttttc ttatgtctcg gcccgcgccg cggtgcgcgt ggcgcgcgaa       600
     ggctggctca tggccgccgt gcgcctgacc tggaagccgc tgctcggcgc gctgatttcc       660
     gcggtgatcc tcggcgcgct gctcgaccac ttcatgccgc aggtcaactc gctgcccgag       720
     gcggtccgcg tcttgctgaa gacgaactga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page