(data stored in SCRATCH zone)

EMBL: CP002417.PE235

CP002417.PE235       Location/Qualifiers
FT   CDS_pept        253037..253987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0236"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: vap:Vapar_0232 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34458"
FT                   /db_xref="GOA:E6V194"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6V194"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADU34458.1"
FT                   /translation="MDSKQVRGIAPDTWGARKWAGIGAAEVMLLLVAAVWGGSYAVAKQ
FT                   ATQQLPVMEFIALRFGLTFIVLLPALKPLFNAQWRQGLAVGGLLGANLLAIFVCETFGV
FT                   SLTTASNAAFLISLCVALTPFVEWWLLGQRPAQRIFWAAGLSAVGAAMLSATSPANIAV
FT                   GWGDALMVLAAFLRAVMVCMTRRLAGHHAMPALTLTAVQSGVMALGAMAISLLASNGAW
FT                   HMPPATASFWWGMAYLVLLCTVFAFFAQNHAASRSSPSRVSLLMGSEPVFGALIAVYGF
FT                   GETVGVWGWAGGLLIVAAAWWVTMPQKLEARPRIP"
     atggattcaa agcaagtgcg gggcatcgca ccggacacgt ggggtgcgag gaagtgggcc        60
     ggcatcggcg ccgccgaggt catgctgctg ctggtggcgg ccgtgtgggg cggcagctat       120
     gcggtcgcga agcaggcgac gcagcagttg cctgtgatgg agttcatcgc gctgcgcttc       180
     gggctcacct tcatcgtgct cttgccggca ctcaagcctc tgttcaatgc gcagtggcgc       240
     caggggctcg cggtgggcgg gctgctcggc gccaacctgc tggcgatctt cgtctgcgag       300
     accttcggcg tgtcgctgac cacggcgagc aacgccgcgt tcctgatcag cctgtgcgtg       360
     gcgctcacgc cgttcgtcga atggtggctg ctggggcagc gcccggcgca gcgcatcttc       420
     tgggccgcgg gcctgtcggc ggtgggagcg gcgatgctgt cggccacctc gcccgccaac       480
     atcgccgtgg gttggggcga cgcgctgatg gtgctcgcgg cgttcctccg cgccgtgatg       540
     gtgtgcatga cgcggcgact cgccggccac cacgcgatgc cggcgctgac gctcaccgcg       600
     gtgcagtcgg gcgtgatggc gctcggcgcg atggcgatct cgctcctagc ctccaacggc       660
     gcctggcaca tgccgcccgc aacggcttcc ttctggtggg gcatggcgta cctcgtgctg       720
     ctgtgcacgg tgttcgcctt cttcgcgcag aaccatgcgg cctcgcgctc gagtccgagc       780
     cgggtgtcgc tgctgatggg gagcgagccg gtgttcggcg cgttgatcgc ggtgtatggg       840
     tttggggaaa cggtcggggt gtggggatgg gccggcgggc tgctgatcgt ggcggcagcg       900
     tggtgggtga cgatgccgca aaagcttgag gcacggccgc gaattccgtg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page