(data stored in ACNUC1104 zone)

EMBL: CP002417.PE237

CP002417.PE237       Location/Qualifiers
FT   CDS_pept        complement(255203..255994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0238"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: vap:Vapar_0235 aldolase II superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34460"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E6V196"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADU34460.1"
FT                   /translation="MNTSLATSPSALVHPSIHPDERAAREELAACYRVFAMLGWVEMIY
FT                   NHITVRLPDSVTGGEKQFLINPFGLHYSEVTASNLVKIDLQGKVLDGSSYPVNPAGFTV
FT                   HAAIHDGLPGAHCVMHTHTTAGVAVACLEGGLRQTNFYTAQLHGMVAYHDFEGITIHAD
FT                   EGPRLLQSIGNRNAVILRNHGLLAWGQTLPQTFAILWTLQRACEIQMATFSMGAAIPVS
FT                   EEIAERCTRDALQFSPAHGAGQDVFNALVRQVDRIDPSYRN"
     atgaacacct cgctcgccac ctcgccttcg gcgctggtcc atccctccat ccaccccgac        60
     gagcgcgccg cgcgcgaaga gctcgcggcc tgctatcgcg tcttcgcgat gctgggctgg       120
     gtcgagatga tctacaacca catcacggtg cggctgcccg acagcgtgac gggcggagag       180
     aagcagttcc tcatcaaccc cttcggcctg cactacagcg aagtgacggc cagcaacctc       240
     gtgaagatcg acctgcaggg caaggtgctc gacggctcgt cgtatccggt gaacccggcc       300
     ggcttcacgg tgcacgcggc catccacgat ggcctgcccg gcgcgcactg cgtgatgcac       360
     acccacacca cggccggcgt ggccgtggcg tgcctggagg gcggcctgcg acagaccaac       420
     ttctataccg cccagctgca cggcatggtg gcgtaccacg acttcgaggg catcacgatc       480
     catgccgacg aaggcccgcg cctcctccag agcatcggca accgcaacgc ggtgatcctg       540
     cgcaaccacg gcctgctggc ctggggccag acgctgccgc agaccttcgc gatcctgtgg       600
     acgctgcagc gcgcctgcga gatccagatg gcgaccttct cgatgggcgc ggccattccg       660
     gtgagcgagg aaatcgccga gcgctgcacc cgcgacgcac tgcagttcag ccccgcgcac       720
     ggcgccgggc aggacgtgtt caatgcgctg gtgcggcagg tggaccgcat cgacccgagc       780
     tacagaaact ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page