(data stored in SCRATCH zone)

EMBL: CP002417.PE24

CP002417.PE24        Location/Qualifiers
FT   CDS_pept        25245..26708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0024"
FT                   /product="Inner membrane CreD family protein"
FT                   /note="PFAM: Inner membrane CreD family protein; KEGG:
FT                   vap:Vapar_0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34247"
FT                   /db_xref="GOA:E6UXQ3"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ3"
FT                   /inference="protein motif:PFAM:PF06123"
FT                   /protein_id="ADU34247.1"
FT                   /translation="MLQFLKALQTSVLAKVAGLFFLTLLLCIPLAEIDSINNARGESQR
FT                   EAAQELAATYASSQTMIGPLLLVPYVERWMEPLRDAQGKVIGQEQRSKEMVHAVFPDKL
FT                   HIEGSMTPQERYRGIFKIPFYTLNATLTGGFTAFDPKVLPHSENDSKIEFKAPFIAFNV
FT                   SDLRGLDGSPALVMGGEALRFKQRVPGLADNAWFADGIHAPVTGAALAAWQANTPLTFE
FT                   MKLGLVGQDTLAIAPIADDTTAHLTSPWAHPSFGGRFLAAQRNVTPQGFDAQWRISSLV
FT                   TSAREQVRAGLSGRVDGNDAAAVATASSARPQRNLGPLQTFDVSLAQPINVYSMSTRAG
FT                   KYGMLFIGLVLMAAFMFELFRKLRLHPIQYGLVGLSIALFFLLLLALSEKFAFWIAYAA
FT                   AASASVALLAVYFSAVLGGWKRGLSFGAFIALLYGALYGLLASESNALLLGALLIFGML
FT                   ATLMLVTRKVDWYALSRRAEPIAPVAQGA"
     atgcttcagt ttctgaaggc acttcagaca tccgtgctgg ccaaggtggc cggcctgttc        60
     ttcctgacgc tgctgctttg cattccgctc gcggagatcg actcgatcaa caacgcacgc       120
     ggcgagagcc agcgcgaagc cgcccaggaa ctcgccgcca cctatgccag cagccagacc       180
     atgatcggcc cgctgttgct ggtgccttat gtcgagcgct ggatggagcc gctgcgcgat       240
     gcgcaaggca aagtgatcgg ccaggagcag cgcagcaagg aaatggtcca cgcggtgttt       300
     cccgacaagc tgcacatcga aggctcgatg acgccgcagg agcggtatcg cggcatcttc       360
     aagattccgt tctacacact caacgccacg ctgaccggcg gcttcacagc cttcgacccc       420
     aaggtcctgc ctcacagcga gaacgattcg aagatcgagt tcaaggcgcc tttcatcgcc       480
     ttcaacgtga gcgacctgcg cggcctcgac ggttcgccgg cgctggtgat gggcggcgag       540
     gcactgcgtt tcaagcagcg cgtgccgggc cttgccgaca acgcctggtt cgccgatggc       600
     atccacgcac cggtcaccgg cgccgcactc gctgcatggc aggccaacac gccactcacc       660
     ttcgagatga agctcggcct cgtcggccag gacaccctcg cgatcgcgcc catcgccgac       720
     gacaccaccg cacacctcac ctcgccctgg gcgcacccca gcttcggtgg ccgctttctc       780
     gcggcgcagc gcaacgtgac gccgcagggc ttcgatgcgc aatggcgcat ctcgtcgctg       840
     gtgacctcgg cgcgcgaaca ggtgcgcgcc ggactctccg gccgcgtcga tggcaacgat       900
     gcagccgcag tggcgacggc gagcagcgcg cgcccgcaac gcaacctcgg cccgctgcag       960
     accttcgacg tgtcgctcgc gcagccgatc aacgtctatt cgatgagcac gcgcgccggc      1020
     aagtacggca tgctcttcat cggcctggtg ctgatggcgg ccttcatgtt cgagctcttc      1080
     cgcaagctgc gcctgcaccc gatccagtac ggcctggtcg gcctttcgat cgcgctgttc      1140
     ttccttttgc tgctcgcgct gtccgagaag ttcgcgttct ggatcgccta tgcggctgca      1200
     gccagcgcca gcgttgcact gctcgccgtg tacttcagcg ccgtgctcgg cggctggaaa      1260
     cgcggcctgt cgttcggtgc cttcatcgcg ctgttgtacg gcgcgctcta tgggctgctc      1320
     gcctccgaaa gcaatgcgct gctgctcggc gcgctgctga tcttcggcat gctggccacg      1380
     ctgatgctgg tgacgcgcaa ggtcgactgg tatgcactgt cgcgccgcgc ggaacccata      1440
     gcacctgttg cacaaggcgc atga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page