(data stored in ACNUC1104 zone)

EMBL: CP002417.PE241

CP002417.PE241       Location/Qualifiers
FT   CDS_pept        complement(258473..259276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0242"
FT                   /product="2-oxo-hepta-3-ene-1,7-dioic acid hydratase"
FT                   /EC_number="4.2.1.80"
FT                   /note="TIGRFAM: 2-oxo-hepta-3-ene-1,7-dioic acid hydratase;
FT                   KEGG: vap:Vapar_0240 2-oxo-hepta-3-ene-1,7-dioic acid
FT                   hydratase; PFAM: fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34464"
FT                   /db_xref="GOA:E6V1A0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012690"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A0"
FT                   /inference="protein motif:TFAM:TIGR02312"
FT                   /protein_id="ADU34464.1"
FT                   /translation="MLSSDTIAKLAAELHESEKSRVQVEHFSKRFPEMTVEDGYAVSRA
FT                   WVKHKIAEGRTVKGHKIGLTSRAMQQSSQIDEPDYGTLLDDMFFAQGGDIPFTRFIAPR
FT                   IEVELAFILGRTLQGPGVTIFDVLAATDYVVPAIEIIDARIEQFDRHTKAPRKVFDTIS
FT                   DNAANAGIVMGGRPVKPDAVDLRWVSALLYKNGVIEETGVAAGVLNHPATGVAWLANKL
FT                   APWDERLEAGEVVLAGSFTRPTTALPGDTFHADYGPLGAISFRLV"
     atgctctctt ccgacaccat tgccaagctg gccgccgagc tgcacgagag cgagaagtcg        60
     cgcgtgcagg tcgagcactt ctccaagcgc tttcccgaga tgaccgtcga agacggctac       120
     gccgtctcgc gcgcatgggt gaagcacaag atcgccgagg gccgcacggt gaagggccac       180
     aagatcggcc tcacctcgcg cgcgatgcag cagtccagcc agatcgacga acccgactac       240
     ggcacgctgc tggacgacat gttcttcgcg cagggcggcg acattccctt cacgcgcttc       300
     atcgcgccgc gcatcgaggt ggagctggcc ttcatcctcg gcaggacgct gcagggcccg       360
     ggcgtgacca tcttcgacgt gctggccgcc accgactacg tggtgccggc catcgagatc       420
     atcgatgcgc gcatcgagca gttcgaccgc cacaccaagg cgccgcgcaa ggtgttcgac       480
     accatctccg acaacgcggc caacgccggc atcgtgatgg gcgggcggcc ggtgaagccc       540
     gatgcggtgg acctgcgctg ggtgagcgcc ctgctctaca agaacggcgt gatcgaggaa       600
     acgggcgtgg ccgcgggcgt gctcaaccac cccgccaccg gcgtggcgtg gctcgcgaac       660
     aagctcgcgc cgtgggacga acgcctcgaa gccggtgaag tggtgctggc gggttccttc       720
     acgcggccga ccacggcgct gccgggcgac accttccatg ccgactacgg ccctctcggc       780
     gcgatctcgt tccgccttgt ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page