(data stored in ACNUC1104 zone)

EMBL: CP002417.PE243

CP002417.PE243       Location/Qualifiers
FT   CDS_pept        complement(259711..260538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0244"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: dac:Daci_0103 extradiol
FT                   ring-cleavage dioxygenase class III protein subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34466"
FT                   /db_xref="GOA:E6V1A2"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A2"
FT                   /inference="protein motif:PFAM:PF02900"
FT                   /protein_id="ADU34466.1"
FT                   /translation="MSLVFAGVCSHAPGITGRAHLADPAVKDEFHAQFHRFGEAMRATK
FT                   PDAVIVIAAEHFANFFMNNMPAYAIGMADSYEGPIEDPKWLGIEKTKVPGDAALSQRLI
FT                   REVMQTVDVAYAEEWKFDHGIMVPLHFLTPAFDTKVIPVNINCQGPPLTPLHRAWAFGE
FT                   ALRRACDNAPERIALVGTGGISHWPATPDSGKVNAEWDAEFMRRWCANDREALLSQDDY
FT                   NDEATYREAGQGGFEIRTFLSVAAAARGKGEIFHMKAIPIFAVTCTAAVMSVA"
     atgagtctcg tattcgcagg cgtgtgcagc cacgcccccg gcatcaccgg ccgcgcgcat        60
     ctcgccgacc cggcggtgaa ggacgagttc cacgcgcagt tccatcgttt cggcgaggcg       120
     atgcgcgcga cgaagcccga cgcggtgatc gtgatcgccg ccgagcactt cgcgaacttc       180
     ttcatgaaca acatgccggc ctacgccatc ggcatggccg acagctacga aggcccgatc       240
     gaagacccga agtggctggg catcgagaag acgaaggtgc ccggcgacgc cgcgctctcg       300
     cagcgcctga tccgcgaggt gatgcagacg gtggacgtgg cctacgcgga agaatggaag       360
     ttcgaccacg gcatcatggt gccgctgcac ttcctcacgc cggccttcga caccaaggtc       420
     atccccgtga acatcaactg ccagggtccg ccgctcacgc cgctgcaccg cgcctgggcc       480
     ttcggcgaag ccttgcgccg cgcctgcgac aacgcgccag agcgcatcgc gctggtgggc       540
     acgggcggca tctcgcactg gccggccacg cccgattcgg gcaaggtgaa cgccgagtgg       600
     gacgccgagt tcatgcgccg ctggtgcgcc aacgaccgcg aggcactgct ctcgcaggac       660
     gactacaacg acgaggccac ctaccgcgaa gcgggccagg gcggcttcga gatccgcacc       720
     ttcctgagcg tggccgcggc cgcgcgcggc aagggcgaga tcttccatat gaaggccatc       780
     ccgatcttcg cggtgacctg cacggccgcc gtcatgtcgg tggcctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page