(data stored in ACNUC1104 zone)

EMBL: CP002417.PE245

CP002417.PE245       Location/Qualifiers
FT   CDS_pept        complement(260877..261860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_0105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34468"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A4"
FT                   /inference="similar to AA sequence:KEGG:Daci_0105"
FT                   /protein_id="ADU34468.1"
FT                   /translation="MNTSRRALLQGAAALAALPSLAPFAHARGDWPNKPVRIVVPFPPG
FT                   GTTDFVARLMAVELGKTLDQAVIVENKPGAGTVIGVDSVAKSAPDGYSFVCVANSFTAN
FT                   QTLVRKLPYDTQKDLRPVALMGMSEHVLATHPSSGLKTLADLRNQAKAKPGTLSFASFG
FT                   NGTSAHLSGEQLKLQMGLDIVHVPYKGQGPALTDLLGGQVTMMFGNWPEFRGQIQSGKL
FT                   VALGMATAQRSQYAPAIPTLAEQGVAIESNSWNGLLAPAGTPDAIVLRMNDEVNRALAG
FT                   PAVTEAFRKGGIASLSGTPERFAAFIQSEIAKYGDVIRKANIQIEG"
     gtgaacacca gccgccgtgc gctgctgcaa ggcgccgccg cgctcgcggc cctgccgtcg        60
     ctcgcgccat tcgcccacgc acgcggcgac tggcccaaca agccggtgcg catcgtcgtg       120
     ccctttccgc ccggcggcac caccgacttc gtcgcgcggc tcatggcggt cgaactcggc       180
     aagacgctcg atcaggcggt gatcgtcgag aacaagcccg gcgcgggcac ggtgatcggc       240
     gtggattcgg tcgccaagtc cgcccccgat ggctacagct tcgtctgcgt ggcgaacagc       300
     ttcacagcca accagacgct ggtgcgcaag ctcccttacg acacgcagaa agacctgcgc       360
     cccgtcgcgc tcatgggcat gtcggaacac gtgctcgcca cgcatccatc gagcggcctg       420
     aagacgctgg ccgacctgcg caaccaggcg aaggcgaagc ccggcacgct gagcttcgcc       480
     tccttcggca acggcacctc ggcgcacctg tcgggcgagc agctcaagct gcagatgggc       540
     ctggacatcg tgcacgtgcc ctacaagggc cagggccccg cgctcactga cctgctcggc       600
     gggcaagtga cgatgatgtt cggcaactgg cccgagttcc gcgggcaaat ccagagcggc       660
     aagctggtcg cgctgggcat ggcgaccgcg cagcgatcgc agtacgcgcc cgcgataccc       720
     acactcgcag aacagggcgt ggccatcgag tccaattcgt ggaacggcct gctggcgccc       780
     gctggcacgc ccgatgccat cgtgctgcgc atgaacgacg aggtgaaccg cgcgctcgcg       840
     ggccctgccg tgaccgaggc tttccgcaag ggcggcatcg cgtcgctgtc gggcacgccc       900
     gagcgcttcg cggcgttcat ccagagcgag atcgcgaagt acggcgacgt gatccgcaag       960
     gccaacatcc agatcgaggg ctga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page