(data stored in SCRATCH zone)

EMBL: CP002417.PE246

CP002417.PE246       Location/Qualifiers
FT   CDS_pept        complement(261857..263323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0247"
FT                   /product="5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /note="KEGG: vap:Vapar_0243
FT                   5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase; TIGRFAM: 5-carboxymethyl-2-hydroxymuconate
FT                   semialdehyde dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34469"
FT                   /db_xref="GOA:E6V1A5"
FT                   /db_xref="InterPro:IPR011985"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A5"
FT                   /inference="protein motif:TFAM:TIGR02299"
FT                   /protein_id="ADU34469.1"
FT                   /translation="MQQINHLIGGKSVTGKDYFETVNPATQEVLAEVASGGEAEVNAAV
FT                   AAAKEAFPKWAGMPAPERAKLIRKLGDLIAAHVPEIAQTETNDCGQVIAQTGKQLIPRA
FT                   ADNFYYFAEMCTRVDGHTYPTPTHLNYTLFHPVGVCALISPWNVPFMTATWKVAPCLAF
FT                   GNTAVLKMSELSPLTAARLGELALEAGIPPGVLNLVHGYGKEAGEPLVAHPDVRAISFT
FT                   GSTATGNRIVKSAGLKKFSMELGGKSPFVIFEDADLDRALDAAVFMIFSNNGERCTAGS
FT                   RILVQQSIYADFAAKFAERAKRITVGDPLDEKTIVGPMISQAHLAKVRSYIELGPKEGA
FT                   TLLCGGLDAPSNLPDRVQRGNYVMPTVFADVDNRMKIAQEEIFGPVACLIPFKDEADAI
FT                   RLANDIQYGLSSYVWTENIGKAHRVAAAVEAGMCFVNSQNVRDLRQPFGGTKASGTGRE
FT                   GGTWSYEVFCEPKNVAVSMGSHHIPHWGVA"
     atgcaacaga tcaaccacct catcggcggc aagtccgtca cgggcaagga ctacttcgaa        60
     accgtcaacc cggccacgca ggaggtgctg gccgaggtcg cctcgggcgg cgaagccgag       120
     gtgaacgcgg ctgtcgccgc ggcgaaggaa gcattcccga aatgggccgg catgcccgcg       180
     cccgaacgcg cgaagctcat ccgcaagctc ggcgacctga tcgccgcgca cgtgcccgag       240
     atcgcgcaga ccgagaccaa cgactgcggc caggtcatcg cgcaaacggg caagcagctc       300
     attccgcgcg cggccgacaa cttctactac ttcgccgaga tgtgcacgcg cgtggacggc       360
     cacacctacc ccacgccgac gcacctgaac tacacgctgt tccacccggt gggcgtgtgc       420
     gcgctcatca gcccgtggaa cgtgccgttc atgacggcca cctggaaggt cgcgccgtgc       480
     ctggccttcg gcaacaccgc ggtgctgaag atgagcgagc tctcgccgct cacggccgcg       540
     cgcctgggtg aactcgcgct cgaagccggc attccgcccg gtgtgctgaa cctcgtgcat       600
     ggctacggca aggaagccgg cgagccgctg gtcgcgcacc ccgatgtgcg cgcgatttcg       660
     ttcaccggtt ccaccgccac gggcaaccgc atcgtgaaga gcgcgggcct caagaagttc       720
     agcatggagc tgggcgggaa aagtccgttc gtgatcttcg aggatgccga cctcgaccgc       780
     gcgctcgacg cggccgtgtt catgatcttc agcaacaacg gcgagcgctg cacggcgggc       840
     tcgcgcatcc tggtgcagca gtcgatttac gccgacttcg ccgcgaagtt cgccgagcgc       900
     gccaagcgca tcacggtggg cgacccgctc gacgagaaga ccatcgtcgg cccgatgatt       960
     tcgcaggccc acctggccaa ggtgcgcagc tacatcgaac tgggtccgaa ggaaggtgcg      1020
     acgctgttgt gcggcggcct cgatgcgccc tcgaacctgc ccgaccgcgt tcagcgcggc      1080
     aactacgtga tgcccaccgt cttcgccgac gtcgacaacc gcatgaagat tgcgcaggaa      1140
     gaaatcttcg gcccggtcgc gtgcctcatc ccgttcaagg acgaggccga tgcgattcgc      1200
     ctcgccaacg acatccagta cggcctctcg agctacgtct ggaccgagaa catcggcaag      1260
     gcgcaccgcg tggccgctgc cgtggaagcc ggcatgtgct tcgtcaacag ccagaacgtg      1320
     cgcgacctgc gccagccctt cggcggcacc aaggcttcgg gcaccggccg cgaaggcggc      1380
     acctggagtt atgaagtgtt ctgcgagccg aagaacgtcg cggtgtcgat gggctcgcac      1440
     cacattccgc actggggcgt ggcgtga                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page